.
The Open Protein Structure Annotation Network
PDB Keyword
.

4qu6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a G-rich RNA sequence binding factor 1 (GRSF1) from Homo sapiens at 1.75 A resolution. To be published
    Site JCSG Biology Target:
    PDB Id 4qu6 Target Id 421651
    Related PDB Ids 2lmi 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS66988,BC040485 Molecular Weight 12369.34 Da.
    Residues 106 Isoelectric Point 4.80
    Sequence skleeevddvfliraqglpwsctmedvlnffsdcrirngengihfllnrdgkrrgdaliemeseqdvqk alekhrmymgqryvevyeinnedvdalmkslqvkssp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.2464
    Matthews' coefficent 1.88 Rfactor 0.1826
    Waters 87 Solvent Content 34.70

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch