.
The Open Protein Structure Annotation Network
PDB Keyword
.

4r03

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (BDI_3222) from Parabacteroides distasonis ATCC 8503 at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 4r03 Target Id 418938
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS93174,YP_001304549.1 Molecular Weight 13105.04 Da.
    Residues 108 Isoelectric Point 5.53
    Sequence kdylydtkeengkiiskvvflqengllnkqvryefqynengkvsekkafrwdrtndewvpfyqityqyd dqsgeiktnygmwdkkkknfslnvqnmiipstnyeeifs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.1876
    Matthews' coefficent 3.29 Rfactor 0.1664
    Waters 192 Solvent Content 62.66

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    A single layer beta sheet protein. This structure is homologous to 3msw, except it contains only three hairpins, rather than four.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch