.
The Open Protein Structure Annotation Network
PDB Keyword
.

4r4k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (BACCAC_01506) from Bacteroides caccae ATCC 43185 at 1.69 A resolution. To be published
    Site JCSG
    PDB Id 4r4k Target Id 419289
    Molecular Characteristics
    Source Bacteroides caccae atcc 43185
    Alias Ids TPS78189,ZP_01959896.1 Molecular Weight 17750.95 Da.
    Residues 153 Isoelectric Point 4.61
    Sequence kneiaqsgedfksfldkftssaafqytrikfplktpitlladdgetektfpftkekwplldsetmkeer ieqeeggiyvskftlnepvhkvfeagyeeseidlrvefeqaadgkwyvvdcytgwygydlpigelkqti qqvkeenaafkeihp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.69 Rfree 0.2026
    Matthews' coefficent 2.61 Rfactor 0.1752
    Waters 633 Solvent Content 52.82

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    FFAS annotation: Hypothetical protein, cystatin-like fold, divergent member of PF14254 family (DUF4348)

     

     

    It is hypothetical protein BACCAC_01506 [Bacteroides caccae ATCC 43185] with the nearest FFAS (-38.3 score) predicted homolog 3sbu (also hypothetical ntf2-like protein).

    The PROFUNC however doesn't come up with NTF2 like assignment for that family. The link for some characteristics of the NTF2- like family based on the known 3sbu structure at:

    http://www.biomedcentral.com/content/pdf/1471-2105-14-327.pdf

    indicates a pure potential non-catalytic ligand-binding role for that target. An obvious consequence of that would be a regulation of protein-like binding partners to this target depending on the small ligand binding status.

    Attached figures shows the dimeric form as predicted by PISA server.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch