.
The Open Protein Structure Annotation Network
PDB Keyword
.

4raa

    Title Crystal structure of a Putative exported protein (BF0058) from Bacteroides fragilis NCTC 9343 at 2.60 A resolution. To be published
    Site JCSG
    PDB Id 4raa Target Id 386541
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS33559,YP_209798.1, 327446 Molecular Weight 41364.33 Da.
    Residues 361 Isoelectric Point 4.68
    Sequence kelhesstiisfkehtdvnadsilelsflklqtkdsclvknvglirelnncllildsansnlyvfnksg afvnqigqkgsgpgeyillssffvdnnknyiaaidiaqdkvlyynatdfsflyerrlpfstscclqled gnllwnsreytdsklsdfyfvvtdslfdiidykmnkefksgyttgpsqmiykvgtnvfaytpfdltiyr vgtseivpahsfsfegtdipsldflnktsnqgnsnylydliqsdyisyycveeterdlfvcymknkeky iglydkntdrtynypikifqdqlkvgelnyfsigsvddyhvapldvlslkdmagngyvfddklsellti sneednsillfvrikk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.2571
    Matthews' coefficent 2.91 Rfactor 0.2140
    Waters 14 Solvent Content 57.77

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein YP_209798.1 is annotated as hypothetical protein BF0058.

    There is no PFAM family assigned to this protein yet. However structural similarity to another protein (pdb code: 3s9j) as revealed by DALI search indicates that it could belong to DUF 4221 family PF13970. This family of bacterial proteins contains highly conserved asparagine and cysteine residues. The function is not known.

    The protein structure consists of six identical  domains arranged in a roughly hexameric configuration, as shown below. Each domain is a four strabded betat-sheet with occasional helices.

    GS13256M.png

    Top 10 DALI Structural Homologs
     
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 3s9j 17.8 3.7 286 362 8 Member of Duf4221 Family
    2 1q7f 15.5 3.7 246 282 10 Brain Tumor Cg10719-pa
    3 3s8z 14.6 3.1 217 606 8 Low-density Lipoprotein Receptor-related Protein
    4 3s8v 14.3 3.2 217 604 8 Low-density Lipoprotein Receptor-related Protein
    5 3s2k 14.2 3.2 215 610 7 Low-density Lipoprotein Receptor-related Protein
    6 4a0p 14.1 3.2 216 609 8 Low-density Lipoprotein Receptor-related Protein
    7 2wg3 14.1 3.9 249 409 8 Desert Hedgehog Protein N-product
    8 3fw0 14.0 3.5 239 329 8 Peptidyl-glycine Alpha-amidating Monooxygenase
    9 3ho5 13.9 4.0 250 451 8 Hedgehog-interacting Protein
    10 3ho3 13.9 3.9 248 442 8 Hedgehog-interacting Protein

     

    A superposition of YP_209798.1 (green) on 3s9j (cyan) shows that these two proteins are very similar.

    GS13256M_3s9j.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     GS13256M.png
    No description
    104.16 kB16:35, 22 Aug 2014abhinavkActions
     GS13256M_3s9j.png
    No description
    160.68 kB16:42, 22 Aug 2014abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch