.
The Open Protein Structure Annotation Network
PDB Keyword
.

4rdb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    PDB Id 4rdb Target Id 425089
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS83674,NP_904517.1, 164 Molecular Weight 33852.48 Da.
    Residues 304 Isoelectric Point 5.17
    Sequence drsieisirvddftktgeavryernqgsaaerlitnlylllfdqsganpakyyitgntftggtwlpddm kvkldmtqseagerkvyvvanvdnavktaldavanesdlqtvkrttampwstdiaspflmsgnkthdfl anrlldnvplvraiakvelnislsekfqivpiivngslsefkfryvnfdketyvvkpttkpdnlissan gvwpqitdwtvwgaslntspapdagtgytldangkvtalrivtylnerdskgatvevalprvddgtlpp pefgpelyrlplpdkilrnhwykyevei
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This structure is a homolog of 3gf8, minor pilin mfa4.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch