.
The Open Protein Structure Annotation Network
PDB Keyword
.

4rho

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    PDB Id 4rho Target Id 373333
    Molecular Characteristics
    Source Burkholderia pseudomallei k96243
    Alias Ids TPS6632,YP_108686.1, BIG_893, 91740 Molecular Weight 26133.24 Da.
    Residues 240 Isoelectric Point 5.41
    Sequence meikamfrdvslssrnfsemlsreskvvaalaaksplmahanwrlkgnsleeatlypafdadgspstpa lavlneeqrgkkhsashaaiwngntrpnegasmschvsdekvlpdrfstrlgvpdcyaksqdladvvtt ivaafnplvveaspegyfdkqvfddkpgvgwmlylpkvitqqqvpearalipvsakgkqtgtiivsvtd apfsvdnpehvaianrieirlvdqdllpayvdi
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    A search of the Pfam database indicates that the C-terminal half (residues 133-240) belong to the Imm32 Pfam Family (PF15579). There are no structural representatives of this Pfam family in the PDB

    Shown below is a ribbons representation of the structure of target id 373333

     

    monomer.png

    The structure shows a six stranded anit-parallel sheet surrounded by alpha-helices. A pseudo two-fold axis into the plane of this view separates the N and C-terminal halves of the subunit. A DALI search shows that target ID 373333 shows remote structural similarty to PDB ID 3C6K, the human spermidine synthease (Z score=6.5, rmsd=3.9 Ang, length of alignment=103, sequence id=9%). 

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     monomer.png
    No description
    205.33 kB21:59, 17 Jul 2014haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch