.
The Open Protein Structure Annotation Network
PDB Keyword
.

1dw9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Cyanase Reveals that a Novel Dimeric and Decameric Arrangement of Subunits is Required for Formation of the Enzyme Active Site. Structure 8 505 2000
    Site MCSG
    PDB Id 1dw9 Target Id APC127
    Related PDB Ids 1dwk 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4454,P00816, 562 Molecular Weight 17047.82 Da.
    Residues 156 Isoelectric Point 5.00
    Sequence miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarlvgakldlde dsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeg geravitldgkylptkpf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 1.65 Rfree 0.189
    Matthews' coefficent 2.53 Rfactor 0.15
    Waters 1865 Solvent Content 51

    Ligand Information
    Ligands SO4 (SULFATE) x 23
    Metals CL (CHLORIDE) x 10

    Jmol

     
    Google Scholar output for 1dw9
    1. An accurate, sensitive, and scalable method to identify functional sites in protein structures
    H Yao, DM Kristensen, I Mihalek, ME Sowa - Journal of molecular , 2003 - Elsevier
     
    2. Looking at enzymes from the inside out: the proximity of catalytic residues to the molecular centroid can be used for detection of active sites and enzyme-ligand
    A Ben-Shimon, M Eisenstein - Journal of molecular biology, 2005 - Elsevier
     
    3. Data mining the protein data bank: residue interactions
    TJ Oldfield - Proteins: Structure, Function, and Bioinformatics, 2002 - Wiley Online Library
     
    4. Structure of cyanase reveals that a novel dimeric and decameric arrangement of subunits is required for formation of the enzyme active site
    MA Walsh, Z Otwinowski, A Perrakis, PM Anderson - Structure, 2000 - Elsevier
     
    5. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    6. Phasing via SAD/MAD data: the method of the joint probability distribution functions
    C Giacovazzo, D Siliqi - Acta Crystallographica Section D: Biological , 2003 - scripts.iucr.org
     
    7. Optimization of selenium substructures as obtained from SHELXD
    F Dall'Antonia, PJ Baker, TR Schneider - Section D: Biological , 2003 - scripts.iucr.org
     
    8. Structural characteristics of novel protein folds
    N Fernandez-Fuentes, JM Dybas, A Fiser - PLoS computational biology, 2010 - dx.plos.org
     
    9. Macromolecular structure solution by charge flipping
    C Dumas, A Van Der Lee - Acta Crystallographica Section D: , 2008 - scripts.iucr.org
     
    10. FINDMOL: automated identification of macromolecules in electron-density maps
    EW McKee, LD Kanbi, KL Childs - Section D: Biological , 2005 - scripts.iucr.org
     
    11. The revenge of the Patterson methods. II. Substructure applications
    MC Burla, R Caliandro, B Carrozzini - Journal of Applied , 2007 - scripts.iucr.org
     
    12. Combining image-seeking functions and a subtraction strategy: a vector-space procedure to improve many-body searches in molecular replacement
    C Alvarez-Rua, J Borge, S Garcia-Granda - Acta Crystallographica Section , 2002 - iucr.org
     
    13. Rapid chain tracing of polypeptide backbones in electron-density maps
    TC Terwilliger - Acta Crystallographica Section D: Biological , 2010 - scripts.iucr.org
     
    14. Analysis of transmembrane and globular protein depending on their solvent energy
    S Wakadkar - his.diva-portal.org
     
    15. Identification of active sites in enzymes
    A Ben-Shimon, M Eisenstein - US Patent App. 11/359,514, 2006 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch