.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ej2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Insights into ligand binding and catalysis of a central step in NAD+ synthesis: structures of Methanobacterium thermoautotrophicum NMN adenylyltransferase complexes. J.Biol.Chem. 276 7225-7232 2001
    Site NESGC
    PDB Id 1ej2 Target Id TT4
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS4429,PF01467, 3.40.50.620 Molecular Weight 20569.71 Da.
    Residues 181 Isoelectric Point 5.75
    Sequence mmtmrgllvgrmqpfhrghlqviksileevdeliicigsaqlshsirdpftagervmmltkalsengip asryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevtapplfyrdrysgtevrrr mlddgdwrsllpesvvevideingverikhlakkevselggis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.241
    Matthews' coefficent 3.06 Rfactor 0.211
    Waters 120 Solvent Content 59.76

    Ligand Information
    Ligands SO4 (SULFATE) x 1;NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 1ej2
    1. Structural proteomics of an archaeon
    D Christendat, A Yee, A Dharamsi, Y Kluger - nature structural , 2000 - pdg.cnb.uam.es
     
    2. Structural proteomics of an archaeon
    D Christendat, A Yee, A Dharamsi, Y Kluger - nature structural , 2000 - pdg.cnb.uam.es
     
    3. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    4. A structurally conserved water molecule in Rossmann dinucleotide_binding domains
    CA Bottoms, PE Smith, JJ Tanner - Protein science, 2002 - Wiley Online Library
     
    5. Monophyly of class I aminoacyl tRNA synthetase, USPA, ETFP, photolyase, and PP_ATPase nucleotide_binding domains: implications for protein evolution in the RNA
    L Aravind, V Anantharaman - : Structure, Function, and , 2002 - Wiley Online Library
     
    6. Are acidic and basic groups in buried proteins predicted to be ionized?
    J Kim, J Mao, MR Gunner - Journal of molecular biology, 2005 - Elsevier
     
    7. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    8. A structurally conserved water molecule in Rossmann dinucleotide_binding domains
    CA Bottoms, PE Smith, JJ Tanner - Protein science, 2002 - Wiley Online Library
     
    9. Monophyly of class I aminoacyl tRNA synthetase, USPA, ETFP, photolyase, and PP_ATPase nucleotide_binding domains: implications for protein evolution in the RNA
    L Aravind, V Anantharaman - : Structure, Function, and , 2002 - Wiley Online Library
     
    10. Are acidic and basic groups in buried proteins predicted to be ionized?
    J Kim, J Mao, MR Gunner - Journal of molecular biology, 2005 - Elsevier
     
    11. Crystal structure of haemophilus influenzae NadR protein
    SK Singh, OV Kurnasov, B Chen, H Robinson - Journal of Biological , 2002 - ASBMB
     
    12. Crystal structure of human nicotinamide mononucleotide adenylyltransferase in complex with NMN
    E Werner, M Ziegler, F Lerner, M Schweiger - FEBS letters, 2002 - Elsevier
     
    13. Crystal structure of human nicotinamide mononucleotide adenylyltransferase in complex with NMN
    E Werner, M Ziegler, F Lerner, M Schweiger - FEBS letters, 2002 - Elsevier
     
    14. Real_time ligand binding pocket database search using local surface descriptors
    R Chikhi, L Sael, D Kihara - Proteins: Structure, Function, and , 2010 - Wiley Online Library
     
    15. Rank information: A structure_independent measure of evolutionary trace quality that improves identification of protein functional sites
    H Yao, I Mihalek, O Lichtarge - Proteins: Structure, Function, , 2006 - Wiley Online Library
     
    16. Rank information: A structure_independent measure of evolutionary trace quality that improves identification of protein functional sites
    H Yao, I Mihalek, O Lichtarge - Proteins: Structure, Function, , 2006 - Wiley Online Library
     
    17. Real_time ligand binding pocket database search using local surface descriptors
    R Chikhi, L Sael, D Kihara - Proteins: Structure, Function, and , 2010 - Wiley Online Library
     
    18. On the diversity of physicochemical environments experienced by identical ligands in binding pockets of unrelated proteins
    A Kahraman, RJ Morris, RA Laskowski - Proteins: Structure, , 2010 - Wiley Online Library
     
    19. On the diversity of physicochemical environments experienced by identical ligands in binding pockets of unrelated proteins
    A Kahraman, RJ Morris, RA Laskowski - Proteins: Structure, , 2010 - Wiley Online Library
     
    20. Oligomeric state in the crystal structure of modular FAD synthetase provides insights into its sequential catalysis in prokaryotes
    B Herguedas, M Martnez-Jlvez, S Frago - Journal of molecular , 2010 - Elsevier
     
    21. Oligomeric state in the crystal structure of modular FAD synthetase provides insights into its sequential catalysis in prokaryotes
    B Herguedas, M Martnez-Jlvez, S Frago - Journal of molecular , 2010 - Elsevier
     
    22. Crystallization and preliminary X-ray analysis of human nicotinamide mononucleotide adenylyltransferase (NMNAT)
    E Werner, M Ziegler, F Lerner, M Schweiger - Section D: Biological , 2001 - scripts.iucr.org
     
    23. Crystallization and preliminary X-ray analysis of human nicotinamide mononucleotide adenylyltransferase (NMNAT)
    E Werner, M Ziegler, F Lerner, M Schweiger - Section D: Biological , 2001 - scripts.iucr.org
     
    24. An efficient algorithm for matching protein binding sites for protein function prediction
    L Ellingson, J Zhang - Proceedings of the 2nd ACM Conference on , 2011 - dl.acm.org
     
    25. An efficient algorithm for matching protein binding sites for protein function prediction
    L Ellingson, J Zhang - Proceedings of the 2nd ACM Conference on , 2011 - dl.acm.org
     
    26. Hidden Relationship between Conserved Residues and Locally Conserved Phosphate-Binding Structures in NAD (P)-Binding Proteins
    CY Wu, YH Hwa, YC Chen, C Lim - The Journal of Physical , 2012 - ACS Publications
     
    27. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    28. Hidden Relationship between Conserved Residues and Locally Conserved Phosphate-Binding Structures in NAD (P)-Binding Proteins
    CY Wu, YH Hwa, YC Chen, C Lim - The Journal of Physical , 2012 - ACS Publications
     
    29. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    30. Crystal structure of haemophilus influenzae NadR protein
    SK Singh, OV Kurnasov, B Chen, H Robinson - Journal of Biological , 2002 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch