.
The Open Protein Structure Annotation Network
PDB Keyword
.

1g2r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Streptococcus pneumonia YlxR at 1.35 A shows a putative new fold. Acta Crystallogr.,Sect.D 57 1747-1751 2001
    Site MCSG
    PDB Id 1g2r Target Id APC085
    Molecular Characteristics
    Source Streptococcus pneumoniae
    Alias Ids TPS4443,NP_345070, 1313 Molecular Weight 11239.47 Da.
    Residues 97 Isoelectric Point 9.62
    Sequence mktrkiplrksvvsnevidkrdllrivknkegqvfidptgkangrgayikldnaealeakkkkvfnrsf smeveesfydeliayvdhkvkrrelgle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.1846
    Matthews' coefficent 2.18 Rfactor 0.1568
    Waters 131 Solvent Content 43.62

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 1g2r
    1. Structural classification of zinc fingers
    SS Krishna, I Majumdar, NV Grishin - Nucleic Acids Research, 2003 - Oxford Univ Press
     
    2. Making optimal use of empirical energy functions: Force_field parameterization in crystal space
    E Krieger, T Darden, SB Nabuurs - PROTEINS: , 2004 - Wiley Online Library
     
    3. Are acidic and basic groups in buried proteins predicted to be ionized?
    J Kim, J Mao, MR Gunner - Journal of molecular biology, 2005 - Elsevier
     
    4. Optimization of protein force-field parameters with the Protein Data Bank
    Y Sakae, Y Okamoto - Chemical physics letters, 2003 - Elsevier
     
    5. JEvTrace: refinement and variations of the evolutionary trace in JAVA
    MP Joachimiak, FE Cohen - Genome Biol, 2002 - biomedcentral.com
     
    6. Streptococcus pneumonia YlxR at 1.35 A shows a putative new fold
    J Osipiuk, P Gornicki, L Maj, I Dementieva - Section D: Biological , 2001 - scripts.iucr.org
     
    7. SURVEY AND SUMMARY: Structural classification of zinc fingers
    SS Krishna, I Majumdar, NV Grishin - Nucleic acids research, 2003 - ncbi.nlm.nih.gov
     
    8. Contact prediction for beta and alpha_beta proteins using integer linear optimization and its impact on the first principles 3D structure prediction method ASTRO_FOLD
    R Rajgaria, Y Wei, CA Floudas - Proteins: Structure, Function, , 2010 - Wiley Online Library
     
    9. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: validation
    FJ Stevens - Journal of Molecular Recognition, 2005 - Wiley Online Library
     
    10. Structure-based functional inference of hypothetical proteins from Mycoplasma hyopneumoniae
    MM Da Fonsca, A Zaha, ER Caffarena - Journal of Molecular , 2011 - Springer
     
    11. Zinc_finger Genes
    RP Grant, M Crossley, JP Mackay - eLS, 2007 - Wiley Online Library
     
    12. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    13. Optimizations of protein force fields
    Y Sakae, Y Okamoto - Arxiv preprint arXiv:1208.6150, 2012 - arxiv.org
     
    14. Using the CONNJUR Database to Analyze Atomic Bond Characteristics as they Relate to Surface Topology of Protein Molecules
    RE Raupach - ewp.rpi.edu
     
    15. Reprsentation simplifie des protines
    A Annexe - theses.ulb.ac.be
     
    16. Rosario Ivetth Corona de la Fuente
    YAPORELS COMIT - estudiantes.cicese.mx
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch