.
The Open Protein Structure Annotation Network
PDB Keyword
.

1g6o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hexameric traffic ATPase of the Helicobacter pylori type IV secretion system. Mol.Cell 6 1461-1472 2000
    Site MCSG
    PDB Id 1g6o Target Id APC784
    Molecular Characteristics
    Source Helicobacter pylori
    Alias Ids TPS4478,E64585, 210 Molecular Weight 37577.84 Da.
    Residues 330 Isoelectric Point 6.43
    Sequence mtedrlsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlknngewqpfd vrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlspvtvndetisisiripskt typhsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkttyiksimefipkeeriisiedt eeivfkhhknytqlffggnitsadclksclrmrpdriilgelrsseaydfynvlcsghkgtlttlhags seeafirlanmsssnsaarnikfesliegfkdlidmivhinhhkqcdefyikhr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.289
    Matthews' coefficent 2.83 Rfactor 0.224
    Waters 295 Solvent Content 56.60

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 2;PEG-PEG-PEG-PEG-PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     
    Google Scholar output for 1g6o
    1. Structural analysis of a set of proteins resulting from a bacterial genomics project
    J Badger, JM Sauder, JM Adams - Proteins: Structure, , 2005 - Wiley Online Library
     
    2. Unveiling molecular scaffolds of the type IV secretion system
    HJ Yeo, G Waksman - Journal of bacteriology, 2004 - Am Soc Microbiol
     
    3. Bacterial surface motility: slime trails, grappling hooks and nozzles
    AJ Merz, KT Forest - Current Biology, 2002 - faculty.washington.edu
     
    4. Analysis of the [pi]-[pi] Stacking Interactions between the Aminoglycoside Antibiotic Kinase APH (3')-IIIa and Its Nucleotide Ligands
    DD Boehr, AR Farley, GD Wright, JR Cox - Chemistry & biology, 2002 - Elsevier
     
    5. Structural studies on MtRecA_nucleotide complexes: Insights into DNA and nucleotide binding and the structural signature of NTP recognition
    S Datta, N Ganesh, NR Chandra - Proteins: Structure, , 2003 - Wiley Online Library
     
    6. An iterative knowledge_based scoring function to predict proteinligand interactions: I. Derivation of interaction potentials
    SY Huang, X Zou - Journal of computational chemistry, 2006 - Wiley Online Library
     
    7. 3D-QSAR study for DNA cleavage proteins with a potential anti-tumor ATCUN-like motif
    H Gonzlez-Daz, Snchez-Gonzlez - Journal of inorganic , 2006 - Elsevier
     
    8. A conformational analysis of Walker motif A [GXXXXGKT (S)] in nucleotide-binding and other proteins
    C Ramakrishnan, VS Dani, T Ramasarma - Protein engineering, 2002 - repository.ias.ac.in
     
    9. Predicting oligomeric assemblies: N-mers a primer
    SR Comeau, CJ Camacho - Journal of structural biology, 2005 - Elsevier
     
    10. Identification, structure and mode of action of a new regulator of the Helicobacter pylori HP0525 ATPase
    S Hare, W Fischer, R Williams, L Terradot, R Bayliss - The EMBO , 2007 - nature.com
     
    11. Topology of the VirB4 C terminus in the Agrobacterium tumefaciens VirB/D4 type IV secretion system
    O Draper, R Middleton, M Doucleff - Journal of Biological , 2006 - ASBMB
     
    12. Rank information: A structure_independent measure of evolutionary trace quality that improves identification of protein functional sites
    H Yao, I Mihalek, O Lichtarge - Proteins: Structure, Function, , 2006 - Wiley Online Library
     
    13. ATCUN_like metal_binding motifs in proteins: Identification and characterization by crystal structure and sequence analysis
    R Sankararamakrishnan, S Verma - Structure, Function, and , 2005 - Wiley Online Library
     
    14. Secretion superfamily ATPases swing big
    SN Savvides - Structure, 2007 - Elsevier
     
    15. Nucleotide Binding States of Subunit A of the A-ATP Synthase and the Implication of P-Loop Switch in Evolution
    A Kumar, MSS Manimekalai, AM Balakrishna - Journal of molecular , 2010 - Elsevier
     
    16. Superimposition of protein structures with dynamically weighted RMSD
    D Wu, Z Wu - Journal of Molecular Modeling, 2010 - Springer
     
    17. Structural Analysis of Hypothetical Proteins from Helicobacter pylori: An Approach to Estimate Functions of Unknown or Hypothetical Proteins
    SJ Park, WS Son, BJ Lee - International Journal of Molecular Sciences, 2012 - mdpi.com
     
    18. STRUCTURAL AND FUNCTIONAL STUDIES ON THE HELICOBACTER PYLORI PROTEOME: THE STATE OF THE ART
    G Zanotti, L Cendron - Functional Proteomics & Nanotechnology- , 2010 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch