.
The Open Protein Structure Annotation Network
PDB Keyword
.

1i36

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title STRUCTURAL SIMILARITIES OF MTH1747 HYPOTHETICAL PROTEIN FROM METHANOBACTERIUM THERMOAUTOTROPHICUM WITH 3-HYDROXYACID DEHYDROGENASES. to be published
    Site MCSG
    PDB Id 1i36 Target Id APC132
    Molecular Characteristics
    Source Methanobacterium thermoautotrophicum
    Alias Ids TPS4458,O27779, 145262 Molecular Weight 28994.64 Da.
    Residues 264 Isoelectric Point 7.67
    Sequence mrvgfigfgevaqtlasrlrsrgvevvtslegrspstierartvgvtetseedvyscpvvisavtpgva lgaarragrhvrgiyvdinnispetvrmassliekggfvdaaimgsvrrkgadiriiasgrdaeefmkl nryglnievrgrepgdasaikmlrssytkgvsallwetltaahrlgleedvlemleytegndfresais rlkssciharrryeemkevqdmlaevidpvmptciirifdklkdvkvsadarlqgca
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.23
    Matthews' coefficent 3.38 Rfactor 0.203
    Waters 421 Solvent Content 63.57

    Ligand Information
    Ligands NAP (NADP) x 2
    Metals

    Jmol

     
    Google Scholar output for 1i36
    1. Progress of structural genomics initiatives: an analysis of solved target structures
    AE Todd, RL Marsden, JM Thornton - Journal of molecular , 2005 - Elsevier
     
    2. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    3. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    4. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    5. Crystal structure of novel NADP-dependent 3-hydroxyisobutyrate dehydrogenase from Thermus thermophilus HB8
    NK Lokanath, N Ohshima, K Takio, I Shiromizu - Journal of molecular , 2005 - Elsevier
     
    6. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    7. Novel identification of expressed genes and functional classification of hypothetical proteins from Neisseria meningitidis serogroup A
    G Bernardini, S Arena, D Braconi, A Scaloni - , 2007 - Wiley Online Library
     
    8. Biochemical Characterization and Crystal Structure of Synechocystis Arogenate Dehydrogenase Provide Insights into Catalytic Reaction
    P Legrand, R Dumas, M Seux, P Rippert, R Ravelli - Structure, 2006 - Elsevier
     
    9. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: validation
    FJ Stevens - Journal of Molecular Recognition, 2005 - Wiley Online Library
     
    10. Probing of Exosites Leads to Novel Inhibitor Scaffolds of HCV NS3/4A Proteinase
    SA Shiryaev, AV Cheltsov, AY Strongin - PloS one, 2012 - dx.plos.org
     
    11. Exploring structurally conserved solvent sites in protein families
    CA Bottoms, TA White, JJ Tanner - : Structure, Function, and , 2006 - Wiley Online Library
     
    12. Bioinformatics of protein bound water
    CA Bottoms - 2005 - mospace.umsystem.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch