The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 2.0 A Crystal Structure of ABC Transporter from Thermotoga maritima. TO BE PUBLISHED
    Site MCSG
    PDB Id 1ji0 Target Id APC046
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4423,AAD36215, 2336 Molecular Weight 26189.41 Da.
    Residues 239 Isoelectric Point 9.17
    Sequence msdivlevqslhvyygaihaikgidlkvprgqivtligangagktttlsaiaglvraqkgkiifngqdi tnkpahvinrmgialvpegrrifpeltvyenlmmgaynrkdkegikrdlewifslfprlkerlkqlggt lsggeqqmlaigralmsrpkllmmdepslglapilvsevfeviqkinqegttillveqnalgalkvahy gyvletgqivlegkaselldnemvrkaylgva
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2640000
    Matthews' coefficent 2.47 Rfactor 0.2420000
    Waters 197 Solvent Content 50.20


    Reactions found in Metabolic Reconstruction for TM1139

    Name: L-threonine transport via ABC system
    Other genes that carryout this rxn: TM1138 TM1135 TM1137 TM1136
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + thr-L[e] --> adp[c] + h[c] + pi[c] + thr-L[c]

    Name: L-valine transport via ABC system
    Other genes that carryout this rxn: TM1138 TM1135 TM1137 TM1136
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + val-L[e] --> adp[c] + h[c] + pi[c] + val-L[c]

    Name: L-alanine transport via ABC system
    Other genes that carryout this rxn: TM1138 TM1135 TM1137 TM1136
    Metabolic Subsystem: Transport
    Reaction: ala-L[e] + atp[c] + h2o[c] --> adp[c] + ala-L[c] + h[c] + pi[c]

    Name: L-leucine transport via ABC system
    Other genes that carryout this rxn: TM1138 TM1135 TM1137 TM1136
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + leu-L[e] --> adp[c] + h[c] + leu-L[c] + pi[c]

    Name: L-isoleucine transport via ABC system
    Other genes that carryout this rxn: TM1138 TM1135 TM1137 TM1136
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + ile-L[e] --> adp[c] + h[c] + ile-L[c] + pi[c]


    Ligand Information


    Google Scholar output for 1ji0
    1. The motor domains of ABC-transporters
    C Oswald, IB Holland, L Schmitt - Naunyn-Schmiedeberg's archives of , 2006 - Springer
    2. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
    3. Building an understanding of cystic fibrosis on the foundation of ABC transporter structures
    JL Mendoza, PJ Thomas - Journal of bioenergetics and biomembranes, 2007 - Springer
    4. Nucleotide-binding domains of human cystic fibrosis transmembrane conductance regulator: detailed sequence analysis and three-dimensional modeling of the
    I Callebaut, R Eudes, JP Mornon, P Lehn - Cellular and molecular life , 2004 - Springer
    5. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org
    6. Coverage of whole proteome by structural genomics observed through protein homology modeling database
    K Yura, A Yamaguchi, M Go - Journal of structural and functional genomics, 2006 - Springer
    7. Identification of molecular determinants that modulate trafficking of _F508 CFTR, the mutant ABC transporter associated with cystic fibrosis
    I Tsigelny, M Hotchko, JXJ Yuan, SH Keller - Cell biochemistry and , 2005 - Springer
    8. Post to
    A Paiardini, R Sali, F Bossa - BMC structural , 2008 - biomedcentral.com
    9. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: validation
    FJ Stevens - Journal of Molecular Recognition, 2005 - Wiley Online Library
    10. Toward understanding the mechanism of action of the yeast multidrug resistance transporter Pdr5p: a molecular modeling study
    RM Rutledge, L Esser, J Ma, D Xia - Journal of structural biology, 2011 - Elsevier
    11. Molecular and functional characterization of CBAVD-causing mutations located in CFTR nucleotide-binding domains
    A Grangeia, R Barro-Soria, F Carvalho - Cellular Physiology , 2008 - content.karger.com
    12. Study on the Structure and Function of Suppressor of K+ Transport Growth Defect (SKD1) Protein from Mesembryanthemum crystallinum using Bioinformatics
    YM Kuo - 2004 - etd.lib.nsysu.edu.tw

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch