.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jq3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of spermidine synthase with a multisubstrate adduct inhibitor. Nat.Struct.Biol. 9 27-31 2002
    Site MCSG
    PDB Id 1jq3 Target Id APC047
    Related PDB Ids 1inl 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4425,AAD35738, 2336 Molecular Weight 34140.37 Da.
    Residues 296 Isoelectric Point 5.30
    Sequence mrtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfaldgitmtt ekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailcevdglvieaarkylkqts cgfddpraeiviangaeyvrkfknefdviiidstdptagqgghlfteefyqacydalkedgvfsaeted pfydigwfklayrriskvfpitrvylgfmttypsgmwsytfaskgidpikdfdpekvrkfnkelkyyne evhvasfalpnfvkkelglm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.2290000
    Matthews' coefficent 2.48 Rfactor 0.1960000
    Waters 743 Solvent Content 50.42

    Pathway

    Reactions found in Metabolic Reconstruction for TM0654

    Name: spermidine synthase
    Metabolic Subsystem: Spermidine Biosynthesis
    Reaction: : ametam + ptrc --> 5mta + h + spmd
    Classification: EC:2.5.1.16
     

    Ligand Information
    Ligands AAT (S-ADENOSYL-1,8-DIAMINO-3-THIOOCTANE) x 3
    Metals

    Jmol

     
    Google Scholar output for 1jq3
    1. SAM (dependent) I AM: the S-adenosylmethionine-dependent methyltransferase fold
    JL Martin, FM McMillan - Current opinion in structural biology, 2002 - Elsevier
     
    2. Structure and mechanism of spermidine synthases
    H Wu, J Min, Y Ikeguchi, H Zeng, A Dong - Biochemistry, 2007 - ACS Publications
     
    3. Conformational selection in silico: loop latching motions and ligand binding in enzymes
    S Wong, MP Jacobson - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    4. Structural and mechanistic insights into the action of Plasmodium falciparum spermidine synthase
    PB Burger, LM Birkholtz, F Joubert, N Haider - Bioorganic & medicinal , 2007 - Elsevier
     
    5. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    6. Mammalian Spermidine SynthaseIdentification of Cysteine Residues and Investigation of the Putrescine Binding Site
    H Goda, T Watanabe, N Takeda, M Kobayashi - Biological and , 2004 - J-STAGE
     
    7. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    8. Low-molecular-weight spies of protein-protein interactions
    J Blobel, R Fayos, J Garca, O Marimon, Y Prez - Comptes Rendus , 2008 - Elsevier
     
    9. Comparative protein modeling of spermidine synthase from Plasmodium falciparum: A potential target for anti-malarial drug therapy
    DMR Reddy - Bioinformation, 2006 - ncbi.nlm.nih.gov
     
    10. The crystal structure of Escherichia coli spermidine synthase SpeE reveals a unique substrate-binding pocket
    X Zhou, TK Chua, KL Tkaczuk, JM Bujnicki - Journal of structural , 2010 - Elsevier
     
    11. A leishmaniasis study: Structure-based screening and molecular dynamics mechanistic analysis for discovering potent inhibitors of spermidine synthase
    A Grover, SP Katiyar, SK Singh, VK Dubey - Biochimica et Biophysica , 2012 - Elsevier
     
    12. PZ Kozbial, AR Mushegian - BMC structural biology, 2005 - BioMed Central Ltd
    79
     
    13. Conformational Sampling of Flexible Ligand-binding Protein Loops
    GR Lee, WH Shin, H Park, S Shin - Bull. Korean Chem. , 2012 - newjournal.kcsnet.or.kr
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1inl.png
    No description
    39.52 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch