.
The Open Protein Structure Annotation Network
PDB Keyword
.

1k6d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Autotracing of Escherichia coli acetate CoA-transferase alpha-subunit structure using 3.4 A MAD and 1.9 A native data. Acta Crystallogr.,Sect.D 58 2116-2121 2002
    Site MCSG
    PDB Id 1k6d Target Id APC250
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4467,P76458, 562 Molecular Weight 23524.92 Da.
    Residues 220 Isoelectric Point 5.10
    Sequence mktklmtlqdatgffrdgmtimvggfmgigtpsrlveallesgvrdltliandtafvdtgigplivngr vrkviashigtnpetgrrmisgemdvvlvpqgtlieqircggaglggfltptgvgtvveegkqtltldg ktwllerplradlalirahrcdtlgnltyqlsarnfnplialaaditlvepdelvetgelqpdhivtpg avidhiivsqesk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.235
    Matthews' coefficent 2.52 Rfactor 0.201
    Waters 228 Solvent Content 51.21

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 1k6d
    1. CaspR: a web server for automated molecular replacement using homology modelling
    JB Claude, K Suhre, C Notredame - Nucleic acids , 2004 - Oxford Univ Press
     
    2. Are acidic and basic groups in buried proteins predicted to be ionized?
    J Kim, J Mao, MR Gunner - Journal of molecular biology, 2005 - Elsevier
     
    3. Automated search-model discovery and preparation for structure solution by molecular replacement
    RM Keegan, MD Winn - Acta Crystallographica Section D: Biological , 2007 - iucr.org
     
    4. Autotracing of Escherichia coli acetate CoA-transferase-subunit structure using 3.4 A MAD and 1.9 A native data
    S Korolev, O Koroleva, K Petterson, M Gu - Section D: Biological , 2002 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch