.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ks2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Escherichia coli ribose-5-phosphate isomerase: a ubiquitous enzyme of the pentose phosphate pathway and the Calvin cycle. STRUCTURE 11 31-42 2003
    Site MCSG
    PDB Id 1ks2 Target Id APC065
    Related PDB Ids 1o8b 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4434,AAC75951, 562 Molecular Weight 22859.15 Da.
    Residues 219 Isoelectric Point 5.20
    Sequence mtqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdasteklkslgihvfd lnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadaskqvdilgkfplpvevipm arsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpiamenainaipgvvtvglfanrgadval igtpdgvktivk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.237
    Matthews' coefficent 2.21 Rfactor 0.224
    Waters 660 Solvent Content 44.28

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ks2
    1. Structure of Escherichia coli Ribose-5-Phosphate Isomerase:: A Ubiquitous Enzyme of the Pentose Phosphate Pathway and the Calvin Cycle
    R Zhang, CE Andersson, A Savchenko, T Skarina - Structure, 2003 - Elsevier
     
    2. Triosephosphate isomerase: a highly evolved biocatalyst
    RK Wierenga, EG Kapetaniou - Cellular and molecular life , 2010 - Springer
     
    3. Structural and Functional Studies of Ribose-5-phosphate isomerase B
    AK Roos - 2007 - uu.diva-portal.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1ks2.png
    No description
    11.82 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch