.
The Open Protein Structure Annotation Network
PDB Keyword
.

1l1s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of hypothetical protein MTH1491 from Methanobacterium thermoautotrophicum. Protein Sci. 11 1409-1414 2002
    Site MCSG
    PDB Id 1l1s Target Id APC079
    Molecular Characteristics
    Source Methanobacterium thermoautotrophicum
    Alias Ids TPS4442,G69065, 145262 Molecular Weight 12552.44 Da.
    Residues 113 Isoelectric Point 4.57
    Sequence mvdyrvvfhideddesrvlllisnvrnlmadlesvrievvaysmgvnvlrrdseysgdvseltgqgvrf cacsntlrasgmdgddllegvdvvssgvghivrrqtegwayirp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.226
    Matthews' coefficent 2.85 Rfactor 0.202
    Waters 19 Solvent Content 56.83

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1l1s
    1. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    2. Structural and molecular genetic insight into a widespread sulfur oxidation pathway
    C Dahl, A Schulte, Y Stockdreher, C Hong - Journal of molecular , 2008 - Elsevier
     
    3. The crystal structure of hypothetical protein MTH1491 from Methanobacterium thermoautotrophicum
    D Christendat, V Saridakis, Y Kim, PA Kumar - Protein , 2002 - Wiley Online Library
     
    4. A novel member of the YchN_like fold: Solution structure of the hypothetical protein Tm0979 from Thermotoga maritima
    JA Gaspar, C Liu, KA Vassall, G Meglei - Protein , 2005 - Wiley Online Library
     
    5. NMR structure of the conserved hypothetical protein TM0979 from Thermotoga maritima
    W Peti, T Herrmann, O Zagnitko - Proteins: Structure, , 2005 - Wiley Online Library
     
    6. Structural study of two proteins SigE and ORF1 to predict their roles in the biochemical oxidation of sulfur anions via the global sulfur oxidation operon ( sox)
    A Bagchi, TC Ghosh - Computational Biology and Chemistry, 2006 - Elsevier
     
    7. Folding and Association of Thermophilic Dimeric and Trimeric DsrEFH Proteins: Tm0979 and Mth1491
    C Galvagnion, MTJ Smith, A Broom, KA Vassall - Biochemistry, 2009 - ACS Publications
     
    8. A Structural Analysis of the Mode of Action of ORF1 in Pseudaminobacter salicylatoxidans: Prediction of its Role in the Global Sulfur Oxidation Operon (sox)
    A Bagchi - Current Proteomics, 2008 - ingentaconnect.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch