.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lj9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Enterococcus faecalis SlyA-like transcriptional factor. J.Biol.Chem. 278 20240-20244 2003
    Site MCSG
    PDB Id 1lj9 Target Id APC100
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS4445,REF02436, 1351 Molecular Weight 17404.09 Da.
    Residues 150 Isoelectric Point 9.16
    Sequence vtdilreigmiaraldsisniefkelsltrgqylylvrvcenpgiiqekiaelikvdrttaaraikrle eqgfiyrqedasnkkikriyatekgknvypiivrenqhsnqvalqglseveisqladylvrmrknvsed wefvkkgntrny
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.275
    Matthews' coefficent 1.99 Rfactor 0.248
    Waters 289 Solvent Content 38.17

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1lj9
    1. Structure of an OhrR-ohrA operator complex reveals the DNA binding mechanism of the MarR family
    M Hong, M Fuangthong, JD Helmann, RG Brennan - Molecular cell, 2005 - Elsevier
     
    2. The importance of alignment accuracy for molecular replacement
    R Schwarzenbacher, A Godzik - Section D: Biological , 2004 - scripts.iucr.org
     
    3. Crystal structure of Enterococcus faecalis SlyA-like transcriptional factor
    R Wu, R Zhang, O Zagnitko, I Dementieva - Journal of Biological , 2003 - ASBMB
     
    4. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    5. Novel Sm-like proteins with long C-terminal tails and associated methyltransferases
    M Albrecht, T Lengauer - FEBS letters, 2004 - Elsevier
     
    6. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    7. Coiled coils: attractive protein folding motifs for the fabrication of self-assembled, responsive and bioactive materials
    B Apostolovic, M Danial, HA Klok - Chem. Soc. Rev., 2010 - xlink.rsc.org
     
    8. Structural Insight on the Mechanism of Regulation of the MarR Family of Proteins: High-Resolution Crystal Structure of a Transcriptional Repressor from
    V Saridakis, D Shahinas, X Xu, D Christendat - Journal of molecular biology, 2008 - Elsevier
     
    9. Identification of amino acid residues of Salmonella SlyA that are critical for transcriptional regulation
    N Okada, Y Oi, M Takeda-Shitaka, K Kanou - , 2007 - Soc General Microbiol
     
    10. Crystal structure of the MarR family regulatory protein, ST1710, from Sulfolobus tokodaii strain 7
    T Kumarevel, T Tanaka, M Nishio, SCB Gopinath - Journal of structural , 2008 - Elsevier
     
    11. ANGLOR: a composite machine-learning algorithm for protein backbone torsion angle prediction
    S Wu, Y Zhang - PLoS One, 2008 - dx.plos.org
     
    12. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    13. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    14. Analysis of protein protein dimeric interfaces
    F Wu, F Towfic, D Dobbs - and Biomedicine, 2007. , 2007 - ieeexplore.ieee.org
     
    15. Stochastic pairwise alignments and scoring methods for comparative protein structure modeling
    AC Marko, K Stafford, T Wymore - Journal of chemical information , 2007 - ACS Publications
     
    16. Crystallization and preliminary X-ray analysis of AbsC, a novel regulator of antibiotic production in Streptomyces coelicolor
    CEM Stevenson, H Kock, S Mootien - Section F: Structural , 2007 - scripts.iucr.org
     
    17. Understanding the role of the topology in protein folding by computational inverse folding experiments
    A Mucherino, S Costantini, D di Serafino - Biology and Chemistry, 2008 - Elsevier
     
    18. The X_ray crystal structure of PA1607 from Pseudomonas aureginosa at 1.9 resolutiona putative transcription factor
    EAL Sieminska, X Xu, A Savchenko - Protein , 2007 - Wiley Online Library
     
    19. LVIS553 transcriptional regulator specifically recognizes novobiocin as an effector molecule
    FA Pagliai, CL Gardner, SG Pande, GL Lorca - Journal of Biological , 2010 - ASBMB
     
    20. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    21. Computational and experimental investigations of forces in protein folding
    DA Schell - 2003 - txspace.di.tamu.edu
     
    22. Protein-protein interface: database, analysis and prediction
    F Wu - 2009 - lib.dr.iastate.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch