.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mkf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Basis of Chemokine Sequestration by a Herpesvirus Decoy Receptor. Cell(Cambridge,Mass.) 111 343-356 2002
    Site MCSG
    PDB Id 1mkf Target Id APC35040
    Molecular Characteristics
    Source Murine herpesvirus type 68
    Alias Ids TPS5488,AAD29402, 33708 Molecular Weight 44229.08 Da.
    Residues 406 Isoelectric Point 4.70
    Sequence maflstsvlikccilllagglaesltlglapalsthssgvstqsvdlsqikrgdeiqahcltpaetevt ecagilkdvlsknlhelqglcnvknkmgvpwvsveelgqeiitgrlpfpsvggtpvndlvrvlvvaesn tpeetpeeefyayvelqtelytfglsddnvvftsdymtvwmidipksyvdvgmltratfleqwpgakvt vmipysstftwcgelgaiseesapqpslsarspvcknsarystskfcevdgctaetgmekmslltpfgg ppqqakmntcpcyykysvsplpamdhliladlagldsltspvyvmaayfdsthenpvrpssklyhcalq mtshdgvwtstsseqcpirlvegqsqnvlqvrvaptsmpnlvgvslmlegqqyrleyfgdh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.273
    Matthews' coefficent 2.66 Rfactor 0.228
    Waters 332 Solvent Content 53.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1mkf
    1. Progress of structural genomics initiatives: an analysis of solved target structures
    AE Todd, RL Marsden, JM Thornton - Journal of molecular , 2005 - Elsevier
     
    2. Structural basis of chemokine sequestration by a herpesvirus decoy receptor
    JM Alexander, CA Nelson, V van Berkel, EK Lau - Cell, 2002 - Elsevier
     
    3. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    4. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    5. Molego_based definition of the architecture and specificity of metal_binding sites
    CH Schein, B Zhou, N Oezguen - Proteins: Structure, , 2005 - Wiley Online Library
     
    6. Efficient comprehensive scoring of docked proteincomplexes-a machine learning approach
    OS Martin - 2006 - kups.ub.uni-koeln.de
     
    7. Context shapes: A novel approach for partial complementary shape matching in proteins
    Z Shentu - 2006 - cs.rpi.edu
     
    8. Optimierte atom-und aminosurespezifische Gewichtungsfaktoren fr Protein-Docking Methoden
    P Heuser - 2006 - kups.ub.uni-koeln.de
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch