.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ml8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics. To be Published
    Site MCSG
    PDB Id 1ml8 Target Id APC5006
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4633,S19719, 562 Molecular Weight 14505.89 Da.
    Residues 134 Isoelectric Point 5.51
    Sequence mqarvkwvegltflgesasghqilmdgnsgdkapspmemvlmaaggcsaidvvsilqkgrqdvvdcevk ltserreadtrlfthinlhfivtgrdlkdaavaravdlsaekycsvalmlekavnithsyevvaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.2679
    Matthews' coefficent 3.11 Rfactor 0.22798
    Waters Solvent Content 60.46

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ml8
    1. The importance of alignment accuracy for molecular replacement
    R Schwarzenbacher, A Godzik - Section D: Biological , 2004 - scripts.iucr.org
     
    2. Combining data from genomes, Y2H and 3D structure indicates that BolA is a reductase interacting with a glutaredoxin
    MA Huynen, CAEM Spronk, T Gabaldn, B Snel - FEBS letters, 2005 - Elsevier
     
    3. Refining homology models by combining replica_exchange molecular dynamics and statistical potentials
    J Zhu, H Fan, X Periole, B Honig - : Structure, Function, and , 2008 - Wiley Online Library
     
    4. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    5. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org
     
    6. Structure of OsmC from Escherichia coli: a salt-shock-induced protein
    DH Shin, IG Choi, D Busso, J Jancarik - Section D: Biological , 2004 - scripts.iucr.org
     
    7. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    8. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch