The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal complexes of a predicted S-adenosylmethionine-dependent methyltransferase reveal a typical AdoMet binding domain and a substrate recognition domain. Protein Sci. 12 1432-1442 2003
    Site MCSG
    PDB Id 1n2x Target Id APC038
    Related PDB Ids 1m6y 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4419,AAD35954, 2336 Molecular Weight 34891.33 Da.
    Residues 299 Isoelectric Point 7.70
    Sequence mrkysqrhipvmvrevieflkpedekiildctvgegghsrailehcpgcriigidvdsevlriaeeklk efsdrvslfkvsyreadfllktlgiekvdgilmdlgvstyqlkgenrgftfereepldmrmdlesevta qkvlnelpeeelariifeygeekrfarriarkivenrplnttldlvkavrealpsyeirrrkrhfatkt fqairiyvnrelenlkeflkkaedllnpggrivvisfhsledrivketfrnskklriltekpvrpseee irenprarsgrlraaerieeggd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.226
    Matthews' coefficent 2.83 Rfactor 0.205
    Waters 349 Solvent Content 56.53

    Ligand Information


    Google Scholar output for 1n2x
    1. Water in protein structure prediction
    GA Papoian, J Ulander, MP Eastwood - Proceedings of the , 2004 - National Acad Sciences
    2. Assessment of homology_based predictions in CASP5
    A Tramontano, V Morea - Proteins: Structure, Function, and , 2003 - Wiley Online Library
    3. CASP5 target classification
    LN Kinch, Y Qi, TJP Hubbard - : Structure, Function, and , 2003 - Wiley Online Library
    4. Crystal complexes of a predicted S_adenosylmethionine_dependent methyltransferase reveal a typical AdoMet binding domain and a substrate recognition domain
    DJ Miller, N Ouellette, E Evdokimova - Protein , 2003 - Wiley Online Library
    5. Domain definition and target classification for CASP6
    M Tress, CH Tai, G Wang, I Ezkurdia - PROTEINS: , 2005 - Wiley Online Library
    6. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
    7. Crystal and solution structures of methyltransferase RsmH provide basis for methylation of C1402 in 16S rRNA
    Y Wei, H Zhang, ZQ Gao, WJ Wang - Journal of Structural , 2012 - Elsevier
    8. AWSEM-MD: Protein Structure Prediction Using Coarse-Grained Physical Potentials and Bioinformatically Based Local Structure Biasing
    A Davtyan, NP Schafer, W Zheng - The Journal of , 2012 - ACS Publications

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    No description
    22.16 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch