.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nc5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.6 A crystal structure of YteR protein from Bacillus subtilis, a predicted lyase. Proteins 60 561-565 2005
    Site MCSG
    PDB Id 1nc5 Target Id APC1644
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4549,O34559, 1423 Molecular Weight 42966.59 Da.
    Residues 373 Isoelectric Point 5.91
    Sequence mgsmdqsiavkspltyaealantimntytveelppanrwhyhqgvflcgvlrlweatgekryfeyakay adlliddngnllfrrdeldaiqaglilfplyeqtkderyvkaakrlrslygtlnrtseggfwhkdgypy qmwldglymggpfalkyanlkqetelfdqvvlqeslmrkhtkdaktglfyhawdeakkmpwaneetgcs pefwarsigwyvmsladmieelpkkhpnrhvwkntlqdmiksicryqdketglwyqivdkgdrsdnwle ssgsclymyaiakginkgyldrayettllkayqgliqhktetsedgaflvkdicvgtsagfydyyvsre rstndlhgagafilamteleplfrsagk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.214
    Matthews' coefficent 2.54 Rfactor 0.187
    Waters 499 Solvent Content 51.56

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1nc5
    1. Identification of the ligand binding sites on the molecular surface of proteins
    K Kinoshita, H Nakamura - Protein Science, 2005 - Wiley Online Library
     
    2. A less laborious approach to the high-throughput production of recombinant proteins in Escherichia coli using 2-liter plastic bottles
    C Sanville Millard, L Stols, P Quartey, Y Kim - Protein expression and , 2003 - Elsevier
     
    3. A novel glycoside hydrolase family 105: the structure of family 105 unsaturated rhamnogalacturonyl hydrolase complexed with a disaccharide in comparison with
    T Itoh, A Ochiai, B Mikami, W Hashimoto - Journal of molecular , 2006 - Elsevier
     
    4. The PDB
    D Fischer, J Pa_, L Rychlewski - Bioinformatics, 2004 - Oxford Univ Press
     
    5. 1.6 crystal structure of YteR protein from Bacillus subtilis, a predicted lyase
    R Zhang, T Minh, L Lezondra, S Korolev - Proteins: Structure, , 2005 - Wiley Online Library
     
    6. Towards High-resolution Computational Approaches for Structure-based Drug Discovery
    J Li - 2011 - academiccommons.columbia.edu
     
    7. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch