.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nc7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Analysis of Thermotoga maritima Hypothetical protein TM1070. To be Published
    Site MCSG
    PDB Id 1nc7 Target Id APC4568
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4612,AAD36147, 2336 Molecular Weight 13060.55 Da.
    Residues 114 Isoelectric Point 7.79
    Sequence mngarkwffpdgyipngkrgylvsheslcimntgdetakiritflfedskpvvheveispmkslhlrld klgipkckpysimaesnvpvvmqlsrldvgknhytlmttigywee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.55 Rfree 0.19
    Matthews' coefficent 1.93 Rfactor 0.1696
    Waters 526 Solvent Content 36.37

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 3;FMT (FORMIC) x 4
    Metals CL (CHLORIDE) x 2;MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 1nc7
    1. Predicting oligomeric assemblies: N-mers a primer
    SR Comeau, CJ Camacho - Journal of structural biology, 2005 - Elsevier
     
    2. Crystal structure of the Anabaena sensory rhodopsin transducer
    L Vogeley, VD Trivedi, OA Sineshchekov - Journal of molecular , 2007 - Elsevier
     
    3. Crystallization, X-ray diffraction analysis and SIRAS/molecular-replacenent phasing of three crystal forms of Anabaena sensory rhodopsin transducer
    L Vogeley, H Luecke - Acta Crystallographica Section F: Structural , 2006 - scripts.iucr.org
     
    4. The PDB
    D Fischer, J Pa_, L Rychlewski - Bioinformatics, 2004 - Oxford Univ Press
     
    5. The Anabaena sensory rhodopsin transducer defines a novel superfamily of prokaryotic small-molecule binding domains
    RF De Souza, LM Iyer, L Aravind - Biology direct, 2009 - biomedcentral.com
     
    6. A eukaryotic-like interaction of soluble cyanobacterial sensory rhodopsin transducer with DNA
    S Wang, SY Kim, KH Jung, V Ladizhansky - Journal of Molecular , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch