.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ne2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Thermoplasma acidophilum 1320 (APC5513). To be Published
    Site MCSG
    PDB Id 1ne2 Target Id APC5513
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS4672,CAC12441, 2303 Molecular Weight 22183.80 Da.
    Residues 197 Isoelectric Point 6.09
    Sequence mgikndleirlqklqqqgnfknyleqyptdastaayflieiyndgniggrsvidagtgngilacgsyll gaesvtafdidpdaietakrncggvnfmvadvseisgkydtwimnppfgsvvkhsdrafidkafetsmw iysignakardflrrefsargdvfreekvyitvpriyrhhsydrarieavifgvrnhsf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.236
    Matthews' coefficent 2.12 Rfactor 0.209
    Waters 250 Solvent Content 41.92

    Ligand Information
    Ligands FMT (FORMIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 1ne2
    1. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch