.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nig

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypothetical protein TA1238 from Thermoplasma acidophilum: a new type of helical super-bundle. J.STRUCT.FUNCT.GENOM. 5 231-240 2004
    Site MCSG
    PDB Id 1nig Target Id APC10009
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS5184,NP_394694, 2303 Molecular Weight 17897.34 Da.
    Residues 152 Isoelectric Point 4.85
    Sequence mdikrycpvtdselpadhvyfkfrseieaaeaylglaisegikvretreildiidtvynslsdpeskln dfqekrlnfteedwydikekanngnrwslymflarsavdsavywsyrmketeefkeivkeemiskllka gyvilreslgevrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.25613
    Matthews' coefficent 2.41 Rfactor 0.21132
    Waters 41 Solvent Content 49.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1nig
    1. Identification of the ligand binding sites on the molecular surface of proteins
    K Kinoshita, H Nakamura - Protein Science, 2005 - Wiley Online Library
     
    2. A periodic table of coiled-coil protein structures
    E Moutevelis, DN Woolfson - Journal of molecular biology, 2009 - Elsevier
     
    3. Structure of ATP-bound human ATP: cobalamin adenosyltransferase
    HL Schubert, CP Hill - Biochemistry, 2006 - ACS Publications
     
    4. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    5. Crystal structure of the hypothetical protein TA1238 from Thermoplasma acidophilum: a new type of helical super-bundle
    R Sanishvili, M Pennycooke, J Gu, X Xu - Journal of structural and , 2005 - Springer
     
    6. EM-Fold: De Novo Atomic-Detail Protein Structure Determination from Medium-Resolution Density Maps
    S Lindert, N Alexander, N Wtzel, M Karaka_ - Structure, 2012 - Elsevier
     
    7. Side-chain rotamers in protein _-_ hairpins and a mechanism of their selection
    AM Kargatov, AV Efimov - Molecular Biology, 2007 - Springer
     
    8. CRYO-EM GUIDED DE NOVO PROTEIN FOLDING
    S Lindert - 2011 - etd.library.vanderbilt.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch