The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Bacillus subtilis YojF protein. To be Published
    Site MCSG
    PDB Id 1njh Target Id APC1392
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4536,O31858, 1423 Molecular Weight 13041.24 Da.
    Residues 116 Isoelectric Point 6.91
    Sequence mkaiikedvqasleryadrpvyihletttgsysahlneknmtvvayirnakvtyhqakikgngpyrvgl kteegwiyaeglteytvdeenrllmaghlpggklaislqisekpftv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.253
    Matthews' coefficent 2.06 Rfactor 0.22
    Waters 89 Solvent Content 40.33

    Ligand Information
    Ligands IPA (ISOPROPYL) x 1;GOL (GLYCEROL) x 1


    Google Scholar output for 1njh
    1. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch