.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nog

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structural basis for methylmalonic aciduria. The crystal structure of archaeal ATP:cobalamin adenosyltransferase. J.Biol.Chem. 279 23646-23653 2004
    Site MCSG
    PDB Id 1nog Target Id APC20011
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS5189,CAC12554, 2303 Molecular Weight 20011.98 Da.
    Residues 177 Isoelectric Point 9.51
    Sequence mftrrgdqgetdlanrarvgkdspvvevqgtidelnsfigyalvlsrwddirndlfriqndlfvlgedv stggkgrtvtremidylearvkemkaeigkielfvvpggsiesaslhmaravsrrlerrivaaskltei nknvliyanrlssilfmhallsnkrlnipekiwsihrvs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.215
    Matthews' coefficent 2.94 Rfactor 0.197
    Waters 170 Solvent Content 58.18

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1nog
    1. Identification of the ligand binding sites on the molecular surface of proteins
    K Kinoshita, H Nakamura - Protein Science, 2005 - Wiley Online Library
     
    2. Functional annotation by identification of local surface similarities: a novel tool for structural genomics
    F Ferr, G Ausiello, A Zanzoni - BMC , 2005 - biomedcentral.com
     
    3. Structural characterization of the active site of the PduO-type ATP: Co (I) rrinoid adenosyltransferase from Lactobacillus reuteri
    MS Maurice, PE Mera, MP Taranto, F Sesma - Journal of Biological , 2007 - ASBMB
     
    4. Structure of ATP-bound human ATP: cobalamin adenosyltransferase
    HL Schubert, CP Hill - Biochemistry, 2006 - ACS Publications
     
    5. Functional insights from structural genomics
    F Forouhar, A Kuzin, J Seetharaman, I Lee - Journal of structural and , 2007 - Springer
     
    6. Understanding protein structure from a percolation perspective
    D Deb, S Vishveshwara, S Vishveshwara - Biophysical journal, 2009 - Elsevier
     
    7. Crystal structure of the hypothetical protein TA1238 from Thermoplasma acidophilum: a new type of helical super-bundle
    R Sanishvili, M Pennycooke, J Gu, X Xu - Journal of structural and , 2005 - Springer
     
    8. Comparing protein contact maps via Universal Similarity Metric: an improvement in the noise-tolerance
    S Rahmati, JI Glasgow - journal of computational biology and drug , 2009 - Inderscience
     
    9. Introduction to protein structure through genetic diseases
    TL Schneider, BR Linton - Journal of Chemical Education, 2008 - ACS Publications
     
    10. Crystallization and preliminary X-ray crystallographic studies of a PduO-type ATP: cob (I) alamin adenosyltransferase from Bacillus cereus
    AK Park, JH Moon, SH Lee, YM Chi - Acta Crystallographica Section , 2008 - scripts.iucr.org
     
    11. Side-chain rotamers in protein _-_ hairpins and a mechanism of their selection
    AM Kargatov, AV Efimov - Molecular Biology, 2007 - Springer
     
    12. Towards High-resolution Computational Approaches for Structure-based Drug Discovery
    J Li - 2011 - academiccommons.columbia.edu
     
    13. The Universal Similarity Metric, applied to contact maps comparison in a two-dimensional space
    S Rahmati - 2008 - catspaw.its.queensu.ca
     
    14. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch