.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nqk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein Alkanesulfonate monooxygenase from E. Coli. To be Published
    Site MCSG
    PDB Id 1nqk Target Id APC5002
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4632,AAC74021, 562 Molecular Weight 41734.00 Da.
    Residues 381 Isoelectric Point 5.69
    Sequence mslnmfwflpthgdghylgteegsrpvdhgylqqiaqaadrlgytgvliptgrscedawlvaasmipvt qrlkflvalrpsvtsptvaarqaatldrlsngralfnlvtgsdpqelagdgvfldhseryeasaeftqv wrrllqretvdfngkhihvrgakllfpaiqqpypplyfggssdvaqelaaeqvdlyltwgeppelvkek ieqvrakaaahgrkirfgirlhvivretndeawqaaerlishlddetiakaqaafartdsvgqqrmaal hngkrdnleispnlwagvglvrggagtalvgdgptvaarineyaalgidsfvlsgyphleeayrvgell fplldvaipeipqpqplnpqgeavandfiprkvaqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.266
    Matthews' coefficent 2.48 Rfactor 0.201
    Waters 144 Solvent Content 50.49

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1nqk
    1. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch