.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nsl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Bacillus subtilis YdaF protein: A putative ribosomal N-acetyltransferase. Proteins 57 850-853 2004
    Site MCSG
    PDB Id 1nsl Target Id APC1068
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4492,P96579, 1423 Molecular Weight 21023.93 Da.
    Residues 183 Isoelectric Point 5.66
    Sequence mftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwrrqyadlngie agllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklityafeelelnrvaicaavgn eksravperigfleegkardglyvngmhhdlvyysllkrewegek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.70 Rfree 0.27817
    Matthews' coefficent 2.76 Rfactor 0.25625
    Waters 19 Solvent Content 57.33

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 6

    Jmol

     
    Google Scholar output for 1nsl
    1. A novel dimeric structure of the RimL N_-acetyltransferase from salmonella typhimurium
    MW Vetting, LPS de Carvalho, SL Roderick - Journal of Biological , 2005 - ASBMB
     
    2. Solution structure of a conserved domain of antizyme: a protein regulator of polyamines
    DW Hoffman, D Carroll, N Martinez, ML Hackert - Biochemistry, 2005 - ACS Publications
     
    3. Crystal structure of Bacillus subtilis YdaF protein: A putative ribosomal N_acetyltransferase
    JS Brunzelle, R Wu, SV Korolev - Proteins: Structure, , 2004 - Wiley Online Library
     
    4. HOMA, Homology Modeling Automatically, and ZebaView: Two bioinformatics applications for structural genomics
    ZB Wunderlich, HR Scholars, GT Montelione - 2003 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch