.
The Open Protein Structure Annotation Network
PDB Keyword
.

1otk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 2 A crystal structure of protein paaC from E. Coli. To be Published
    Site MCSG
    PDB Id 1otk Target Id APC5022
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4638,AAC74472, 562 Molecular Weight 27875.97 Da.
    Residues 248 Isoelectric Point 4.89
    Sequence mnqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelagegdedtla ftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaaisakaikearyhlrfsr gwlerlgngtdvsgqkmqqainklwrftaelfdadeidialseegiavdprtlraaweaevfagineat lnvpqeqayrtggkkglhtehlgpmlaemqylqrvlpgqqw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.229
    Matthews' coefficent 3.22 Rfactor 0.194
    Waters 342 Solvent Content 61.78

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1otk
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. Statistical analysis of interface similarity in crystals of homologous proteins
    Q Xu, AA Canutescu, G Wang, M Shapovalov - Journal of molecular , 2008 - Elsevier
     
    3. The PDB
    D Fischer, J Pa_, L Rychlewski - Bioinformatics, 2004 - Oxford Univ Press
     
    4. A fourier fingerprint-based method for protein surface representation
    MJ Bayley, EJ Gardiner, P Willett - Journal of chemical , 2005 - ACS Publications
     
    5. Side-chain rotamers in protein _-_ hairpins and a mechanism of their selection
    AM Kargatov, AV Efimov - Molecular Biology, 2007 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch