.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ou0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a predicted precorrin-8x methylmutase from Thermoplasma acidophilum. Proteins 58 751-754 2004
    Site MCSG
    PDB Id 1ou0 Target Id APC20010
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS5188,CAC11792, 2303 Molecular Weight 22395.52 Da.
    Residues 207 Isoelectric Point 5.97
    Sequence maaageeyssdkieerslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgffksmlaklke gctiicdsemvragiysrpvlernrvvcylndvrskemadvngitrsaagiriamqdhrnsvivignap talleamrmieengwydipivgipvgfinaskakeglvsshieyisveghrggspiaasivngfgrfla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.235
    Matthews' coefficent 2.08 Rfactor 0.202
    Waters 627 Solvent Content 40.88

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ou0
    1. Crystal structure of a predicted precorrin_8x methylmutase from Thermoplasma acidophilum
    ME Cuff, DJ Miller, S Korolev, X Xu - Proteins: Structure, , 2005 - Wiley Online Library
     
    2. The crystal structure of putative precorrin isomerase CbiC in cobalamin biosynthesis
    Y Xue, Z Wei, X Li, W Gong - Journal of structural biology, 2006 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch