.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pqz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title MURINE CYTOMEGALOVIRUS IMMUNOMODULATORY PROTEIN M144. To be Published
    Site MCSG
    PDB Id 1pqz Target Id APC35021
    Molecular Characteristics
    Source Murine cytomegalovirus
    Alias Ids TPS5487,APC35021, 10366 Molecular Weight 42729.11 Da.
    Residues 383 Isoelectric Point 8.76
    Sequence mralalicvvwvcwrescarhgtedssesglryaytlvvdgtantrrcfgtghvdgeafvgysnnkthg igrwvnashveeenkefvrqckelqaeldkmqnnskvigvktvqldvgctskiekhyaydgneteddta tsaserdrdcqkklteyrklvlasavspqleverrssgreggmrlrcfardyypadleirwwkddgggg alpqtskqhhdplpsgnglyqkhidvyvdgglehvyscrvkgiatglelqivrwkgyargagnsvvlla lfipasvmaavvvgsvlirkkskeqrktrrrfgrrsghepkrpsyqvkrraeppcdlpmtiwfrgdnvm stqveacpayavtmsarelsdawsngdgpivtvpdpsi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.287
    Matthews' coefficent 2.95 Rfactor 0.245
    Waters 172 Solvent Content 58.24

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1pqz
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. Crystal structure of the murine cytomegalovirus MHC-I homolog m144
    K Natarajan, A Hicks, J Mans, H Robinson - Journal of molecular , 2006 - Elsevier
     
    3. Specificity of molecular interactions in transient proteinprotein interaction interfaces
    K Cho, KY Lee, KH Lee, D Kim - : Structure, Function, and , 2006 - Wiley Online Library
     
    4. Bioinformation discovery: data to knowledge in biology
    P Kangueane - 2009 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch