.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pzx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Lipid binding protein APC36103 from Bacillus Stearothermophilus. To be Published
    Site MCSG
    PDB Id 1pzx Target Id APC36103
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5535,RBSTP0788, 1422 Molecular Weight 32357.55 Da.
    Residues 289 Isoelectric Point 6.02
    Sequence nampieiitdsgadlpqsyirehriaflplvvhwngqdykdgitiepkqvydamrqghtvktaqpspla mkelflpyakenrpclyiafssklsgtyqtamavrselldeypefrltiidskcaslgqglavmkavel akqntpynllcetiesycrhmehiftvdnldylarggrisktaaafggllnikpllhvedgaliplekw rgrkkvlkrmvelmgergddlqkqtigishaddeetalelkqmieethgctrfflsdigsaigahagpg tialfflnkyiei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.252
    Matthews' coefficent 2.54 Rfactor 0.197
    Waters 347 Solvent Content 51.59

    Ligand Information
    Ligands PLM (PALMITIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 1pzx
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. Production of selenomethionine-labeled proteins in two-liter plastic bottles for structure determination
    L Stols, CS Millard, I Dementieva - Journal of structural and , 2004 - Springer
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. EDD, a novel phosphotransferase domain common to mannose transporter EIIA, dihydroxyacetone kinase, and DegV
    LN Kinch, S Cheek, NV Grishin - Protein science, 2005 - Wiley Online Library
     
    5. Structure of a fatty acid-binding protein from Bacillus subtilis determined by sulfur-SAD phasing using in-house chromium radiation
    J Nan, Y Zhou, C Yang, E Brostromer - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch