.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q1l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of chorismate synthase from Aquifex aeolicus reveals a novel beta alpha beta sandwich topology. PROTEINS: STRUCT.,FUNCT.,GENET. 54 166-169 2004
    Site MCSG
    PDB Id 1q1l Target Id APC22481
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS5226,NP_213053, 224324 Molecular Weight 44251.34 Da.
    Residues 398 Isoelectric Point 7.13
    Sequence mslrylrfltageshgkgltailegipanlplseeeinhelrrrqrgygrggrmkiekdtaeilsgvrf gktlgspialfirnrdwenwkekmaiegepspsvvpftrprpghadlsggikynqrdlrnilerasare taarvavgavckkflsefgikigsfvvsigqkeveelkdksyfanpekllsyhekaedselripfpekd eefktyidevkekgeslggvfevfalnvppglgshiqwdrridgriaqammsiqaikgveiglgfeaar rfgsqvhdeigwsegkgyfrhsnnlggteggitngmpivvrvamkpiptlknplrsvdietkeemkagk ertdivavpaasvvgeamlaivladalleklggdfmeevkkrfedyvnhvksf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.05 Rfree 0.246
    Matthews' coefficent 2.32 Rfactor 0.209
    Waters 560 Solvent Content 46.97

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1q1l
    1. Structure of chorismate synthase from Mycobacterium tuberculosis
    MVB Dias, JC Borges, F Ely, JH Pereira - Journal of structural , 2006 - Elsevier
     
    2. Crystallization and preliminary X-ray crystallographic analysis of chorismate synthase from Mycobacterium tuberculosis
    MVB Dias, F Ely, F Canduri, JH Pereira - Section D: Biological , 2004 - scripts.iucr.org
     
    3. Crystal structure of chorismate synthase from Aquifex aeolicus reveals a novel beta alpha beta sandwich topology
    CM Viola, V Saridakis - : Structure, Function, and , 2004 - Wiley Online Library
     
    4. A structural model for chorismate synthase from Mycobacterium tuberculosis in complex with coenzyme and substrate
    CL Fernandes, A Breda, D Santiago Santos - Computers in Biology , 2007 - Elsevier
     
    5. Homology modeling and molecular dynamics study of chorismate synthase from Shigella flexneri
    H Zhou, N Singh, KS Kim - Journal of Molecular Graphics and Modelling, 2006 - Elsevier
     
    6. Structural analysis of chorismate synthase from Plasmodium falciparum: A novel target for antimalaria drug discovery
    S Tapas, A Kumar, S Dhindwal, P Kumar - International journal of , 2011 - Elsevier
     
    7. Structure prediction and docking studies of chorismate synthase from mycobacterium tuberculosis
    C Fernandes, D Santos, L Basso - Advances in Bioinformatics , 2005 - Springer
     
    8. Understanding the Structure, Activity and Inhibition of Chorismate Synthase from Mycobacterium tuberculosis
    HA Arcuri, MS Palma - Current Medicinal Chemistry, 2011 - ingentaconnect.com
     
    9. Modelagem molecular e estudos de docking da enzima corismato sintase de Mycobacterium tuberculosis
    CL Fernandes - 2006 - lume.ufrgs.br
     
    10. Estudo Estrutural de Protenas Alvo de Mycobacterium tuberculosis
    MVB Dias - 2007 - athena.biblioteca.unesp.br
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch