.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q77

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural homolog of Universal Stress Protein from Aquifex aeolicus. To be Published
    Site MCSG
    PDB Id 1q77 Target Id APC22268
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS5217,NP_213125, 224324 Molecular Weight 15273.93 Da.
    Residues 135 Isoelectric Point 5.04
    Sequence mkvllvltdaysdcekaityavnfseklgaeldilavledvynleranvtfglpfppeikeeskkrier rlrevwekltgsteipgveyrigplseevkkfvegkgyelvvwacypsaylckvidglnlaslivk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.257
    Matthews' coefficent 4.80 Rfactor 0.22
    Waters 32 Solvent Content 74.35

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1q77
    1. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    2. Production of selenomethionine-labeled proteins in two-liter plastic bottles for structure determination
    L Stols, CS Millard, I Dementieva - Journal of structural and , 2004 - Springer
     
    3. Biochemical properties of UspG, a universal stress protein of Escherichia coli
    A Weber, K Jung - Biochemistry, 2006 - ACS Publications
     
    4. Heterodimer Formation within Universal Stress Protein Classes Revealed By an In Silico and Experimental Approach
    L Nachin, L Brive, KC Persson, P Svensson - Journal of molecular , 2008 - Elsevier
     
    5. Structural Basis of the Initial Binding of tRNAIle Lysidine Synthetase TilS with ATP and L-Lysine
    M Kuratani, Y Yoshikawa, Y Bessho, K Higashijima - Structure, 2007 - Elsevier
     
    6. Structure and function of the universal stress protein TeaD and its role in regulating the ectoine transporter TeaABC of Halomonas elongata DSM 2581T
    ES Schweikhard, SI Kuhlmann, HJ Kunte - Biochemistry, 2010 - ACS Publications
     
    7. The PDB
    D Fischer, J Pa_, L Rychlewski - Bioinformatics, 2004 - Oxford Univ Press
     
    8. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of universal stress protein F (YnaF) from Salmonella typhimurium
    SR Sagurthi, RR Panigrahi, G Gowda - Section F: Structural , 2007 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch