.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q7r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure analysis of a predicted amidotransferase from B. stearothermophilus at 1.9 A resolution. To be Published
    Site MCSG
    PDB Id 1q7r Target Id APC35754
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5508,RBSTP0199, 1422 Molecular Weight 21362.65 Da.
    Residues 196 Isoelectric Point 6.22
    Sequence mkigvlglqgavrehvraieacgaeavivkkseqlegldglvlpggesttmrrlidryglmeplkqfaa agkpmfgtcaglillakrivgydephlglmditvernsfgrqresfeaelsikgvgdgfvgvfiraphi veagdgvdvlatyndrivaarqgqflgcsfhpeltddhrlmqyflnmvkeakmasslk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.23231
    Matthews' coefficent 2.09 Rfactor 0.19313
    Waters 126 Solvent Content 41.25

    Ligand Information
    Ligands SO4 (SULFATE) x 1;EDO (1,2-ETHANEDIOL) x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 1q7r
    1. Structural insights into the mechanism of the PLP synthase holoenzyme from Thermotoga maritima
    F Zein, Y Zhang, YN Kang, K Burns, TP Begley - Biochemistry, 2006 - ACS Publications
     
    2. A new arrangement of (_/_) 8 barrels in the synthase subunit of PLP synthase
    J Zhu, JW Burgner, E Harms, BR Belitsky - Journal of Biological , 2005 - ASBMB
     
    3. Coenzyme biosynthesis: enzyme mechanism, structure and inhibition
    DE Scott, A Ciulli, C Abell - Natural product reports, 2007 - pubs.rsc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch