.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q8b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 1.9A crystal structure of protein YJCS from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 1q8b Target Id APC1224
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4517,O31641, 1423 Molecular Weight 12455.84 Da.
    Residues 105 Isoelectric Point 5.55
    Sequence mkshkmmgggismhyitaclkiisdkdlneimkefkkleeetnkeegcitfhayplepserkimlweiw eneeavkihftkkhtidvqkqeltevewlmksnvnd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.257
    Matthews' coefficent 2.83 Rfactor 0.207
    Waters 120 Solvent Content 56.59

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1q8b
    1. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    2. A novel chimera: The truncated hemoglobin-antibiotic monooxygenase from Streptomyces avermitilis
    A Bonamore, A Attili, F Arenghi, B Catacchio - Gene, 2007 - Elsevier
     
    3. The crystal structure of Rv0793, a hypothetical monooxygenase from M._ tuberculosis
    MJ Lemieux, C Ference, MM Cherney, M Wang - Journal of structural and , 2005 - Springer
     
    4. Structural insight of the role of the Hahella chejuensis HapK protein in prodigiosin biosynthesis
    HJ Cho, KJ Kim, MH Kim - : Structure, Function, and , 2008 - Wiley Online Library
     
    5. The X_ray crystal structure of PA3566 from Pseudomonas aureginosa at 1.8 resolution
    DAR Sanders, JR Walker, T Skarina - Proteins: Structure, , 2005 - Wiley Online Library
     
    6. Crystal structure and catalytic mechanism of 4-methylmuconolactone methylisomerase
    M Marn, DW Heinz, DH Pieper, BU Klink - Journal of Biological Chemistry, 2009 - ASBMB
     
    7. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    8. Structure to function
    JD Watson, JM Thornton, ML Tress, G Lopez - 2008 - books.google.com
     
    9. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    10. Structural bioinformatics: from protein structure to function
    AM Edwards, JD Watson, A Golovin - Evolving Methods for , 2007 - Springer
     
    11. STRUCTURAL BIOINFORMATICS: FROM PROTEIN STRUCTURE TO FUNCTION
    JD WATSON, A GOLOVIN - Evolving methods for , 2007 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch