.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q8i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Escherichia Coli DNA Polymerase II. To be Published
    Site MCSG
    PDB Id 1q8i Target Id APC50001
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS5546,P21189, 562 Molecular Weight 89916.77 Da.
    Residues 782 Isoelectric Point 6.41
    Sequence aqagfiltrhwrdtpqgtevsfwlatdngplqvtlapqesvafipadqvpraqhilqgeqgfrltplal kdfhrqpvyglycrahrqlmnyekrlreggvtvyeadvrpperylmerfitspvwvegdmhngtivnar lkphpdyrpplkwvsidiettrhgelyciglegcgqrivymlgpengdassldfeleyvasrpqllekl nawfanydpdviigwnvvqfdlrmlqkhaeryrlplrlgrdnselewrehgfkngvffaqakgrliidg iealksafwnfssfsletvaqellgegksidnpwdrmdeidrrfaedkpalatynlkdcelvtqifhkt eimpflleratvnglpvdrhggsvaafghlyfprmhragyvapnlgevpphaspggyvmdsrpglydsv lvldykslypsiirtflidpvglvegmaqpdpehstegfldawfsrekhclpeivtniwhgrdeakrqg nkplsqalkiimnafygvlgttacrffdprlassitmrghqimrqtkalieaqgydviygdtdstfvwl kgahseeeaakigralvqhvnawwaetlqkqrltsaleleyethfcrflmptirgadtgskkryagliq egdkqrmvfkgletvrtdwtplaqqfqqelylrifrnepyqeyvretidklmageldarlvyrkrlrrp lseyqrnvpphvraarladeenqkrgrplqyqnrgtikyvwttngpepldyqrspldyehyltrqlqpv aegilpfiednfatlmtgqlglf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.23612
    Matthews' coefficent 2.76 Rfactor 0.19672
    Waters 416 Solvent Content 55.15

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1q8i
    1. Protein function prediction using local 3D templates
    RA Laskowski, JD Watson, JM Thornton - Journal of Molecular Biology, 2005 - Elsevier
     
    2. Insights into strand displacement and processivity from the crystal structure of the protein-primed DNA polymerase of bacteriophage _29
    S Kamtekar, AJ Berman, J Wang, JM Lzaro - Molecular cell, 2004 - Elsevier
     
    3. Structural and biochemical investigation of the role in proofreading of a _ hairpin loop found in the exonuclease domain of a replicative DNA polymerase of the B
    M Hogg, P Aller, W Konigsberg, SS Wallace - Journal of Biological , 2007 - ASBMB
     
    4. Structural insight into translesion synthesis by DNA Pol II
    F Wang, W Yang - Cell, 2009 - Elsevier
     
    5. Evolution of DNA polymerases: an inactivated polymerase-exonuclease module in Pol epsilon and a chimeric origin of eukaryotic polymerases from two classes
    TH Tahirov, KS Makarova, IB Rogozin, YI Pavlov - Biol , 2009 - biomedcentral.com
     
    6. tRNAHis guanylyltransferase (THG1), a unique 3_-5_ nucleotidyl transferase, shares unexpected structural homology with canonical 5_-3_ DNA polymerases
    SJ Hyde, BE Eckenroth, BA Smith - Proceedings of the , 2010 - National Acad Sciences
     
    7. The origin of a derived superkingdom: how a gram-positive bacterium crossed the desert to become an archaeon
    RE Valas, PE Bourne - Biology direct, 2011 - biomedcentral.com
     
    8. Structural Phylogenomics: Selection Pressure Suggests the Functionally Important Residues Encoded by Cisplatin Resistance Related 9 Gene
    S Shakir, WA Waseem, SK Hasan, M Munir - EDITORIAL , 2011 - duhs.edu.pk
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch