.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q9u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure analysis of Zinc-binding, uncharacterized protein from Bacillus stearothermophilus. To be Published
    Site MCSG
    PDB Id 1q9u Target Id APC35924
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5527,RBSTP0257, 1422 Molecular Weight 14329.98 Da.
    Residues 127 Isoelectric Point 4.90
    Sequence mfhytvdvstgmnetierleeslkqegfgvlwqfsvteklqekgldfstpmvilevcnpqeaarvlnen llvgyflpcklvvyqengttkigmpkptmlvgmmndpalkeiaadiekrlaacldrcr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.241
    Matthews' coefficent 1.91 Rfactor 0.192
    Waters 336 Solvent Content 35.49

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 17

    Jmol

     
    Google Scholar output for 1q9u
    1. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    2. Production of selenomethionine-labeled proteins in two-liter plastic bottles for structure determination
    L Stols, CS Millard, I Dementieva - Journal of structural and , 2004 - Springer
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch