.
The Open Protein Structure Annotation Network
PDB Keyword
.

1qz4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a hypothetical protein ycfC coded by Escherichia coli genome. To be Published
    Site MCSG
    PDB Id 1qz4 Target Id APC70001
    Related PDB Ids 1sdi 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS5574,P25746, 562 Molecular Weight 22946.26 Da.
    Residues 213 Isoelectric Point 9.34
    Sequence maknyyditlalagicqsarlvqqlahqghcdadalhvslnsiidmnpsstlavfggseanlrvgletl lgvlnassrqglnaeltrytlslmvlerklssakgaldtlgnringlqrqlehfdlqsetlmsamaaiy vdvisplgpriqvtgspavlqspqvqakvratllagiraavlwhqvgggrlqlmfsrnrlttqakqila hltpel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree
    Matthews' coefficent 2.02 Rfactor
    Waters 111 Solvent Content 39.09

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals HG (MERCURY) x 10

    Jmol

     
    Google Scholar output for 1qz4
    1. Multipass membrane protein structure prediction using Rosetta
    V Yarov_Yarovoy, J Schonbrun - : Structure, Function, and , 2006 - Wiley Online Library
     
    2. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. HflD, an Escherichia coli protein involved in the _ lysislysogeny switch, impairs transcription activation by _CII
    PK Parua, A Mondal, P Parrack - Archives of biochemistry and biophysics, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch