.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r1d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a Carboxylesterase from Bacillus stearothermophilus. TO BE PUBLISHED
    Site MCSG
    PDB Id 1r1d Target Id APC36123
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5537,RBSTP1697, 1422 Molecular Weight 28223.90 Da.
    Residues 246 Isoelectric Point 5.17
    Sequence mkivppkpfffeageravlllhgftgnsadvrmlgrfleskgytchapiykghgvppeelvhtgpddww qdvmngyqflknkgyekiavaglslggvfslklgytvpiegivtmcapmyikseetmyegvleyareyk kregkseeqieqemerfkqtpmktlkalqeliadvrahldlvyaptfvvqarhdeminpdsaniiynei espvkqikwyeqsghvitldqekdqlhediyaflesldw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.245
    Matthews' coefficent 3.14 Rfactor 0.205
    Waters 658 Solvent Content 60.78

    Ligand Information
    Ligands EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1r1d
    1. Covalent Reaction Intermediate Revealed in Crystal Structure of the Geobacillus stearothermophilus Carboxylesterase Est30
    P Liu, YF Wang, HE Ewis, AT Abdelal, CD Lu - Journal of molecular , 2004 - Elsevier
     
    2. Molecular Healing of Polymeric Materials, Coatings, Plastics, Elastomers, Composites, Laminates, Adhesives, and Sealants by Active Enzymes
    CS McDaniel, ME Wales, J Rawlins, P Cipi - US Patent App. 12/ , 2010 - Google Patents
     
    3. The structure of monoacylglycerol lipase from Bacillus sp. H257 reveals unexpected conservation of the cap architecture between bacterial and human enzymes
    S Rengachari, GA Bezerra, L Riegler-Berket - et Biophysica Acta (BBA , 2012 - Elsevier
     
    4. Structural, Kinetic and Mutational Analysis of Two Bacterial Carboxylesterases
    P Liu - 2007 - digitalarchive.gsu.edu
     
    5. Prediction of Protein Function Using Statistically Significant Sub-Structure Discovery
    C Lucas - 2007 - etheses.whiterose.ac.uk
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch