.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r4v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of Aq_328 from the hyperthermophilic bacteria Aquifex aeolicus shows an ancestral histone fold. Proteins 62 8-16 2006
    Site MCSG
    PDB Id 1r4v Target Id APC22301
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS5222,NP_213225, 224324 Molecular Weight 19793.73 Da.
    Residues 171 Isoelectric Point 5.46
    Sequence mqekynfgkvssqhknyskietmlrpkgfdkldhyfrteldidltdetielllnsvkaafgklfygaeq rarwngrdfialadlnitkaleehiknfqkieqdmgvdelleyiafippvemnvgedlkseyrnimggl llmhadvikkatgerkpsreamefvaqivdkvf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.21311
    Matthews' coefficent 2.75 Rfactor 0.1806
    Waters 224 Solvent Content 55.31

    Ligand Information
    Ligands CAC (CACODYLATE) x 1
    Metals ZN (ZINC) x 3

    Jmol

     
    Google Scholar output for 1r4v
    1. Mass fractal dimension and the compactness of proteins
    MB Enright, DM Leitner - Physical Review E, 2005 - APS
     
    2. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    3. On the origin of the histone fold
    V Alva, M Ammelburg, J Sding - BMC structural biology, 2007 - biomedcentral.com
     
    4. Discrimination between distant homologs and structural analogs: lessons from manually constructed, reliable data sets
    H Cheng, BH Kim, NV Grishin - Journal of molecular biology, 2008 - Elsevier
     
    5. The crystal structure of Aq_328 from the hyperthermophilic bacteria Aquifex aeolicus shows an ancestral histone fold
    Y Qiu, V Tereshko, Y Kim, R Zhang - Proteins: Structure, , 2006 - Wiley Online Library
     
    6. The histone database: an integrated resource for histones and histone fold-containing proteins
    L Mario-Ramrez, KM Levine, M Morales - Database: the journal , 2011 - ncbi.nlm.nih.gov
     
    7. Limits of Constitutional Text and Structure Revisited, The
    A Stone - UNSWLJ, 2005 - HeinOnline
     
    8. Crystal Structure of AQ_328 from A. aeolicus
    A Kossiakoff, A Joachimiak - of 10~(th) International Conference on , 2004 - cpfd.cnki.com.cn
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch