.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r61

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of potential metal-dependent hydrolase with cyclase activity. To be Published
    Site MCSG
    PDB Id 1r61 Target Id APC35841
    Related PDB Ids 3krv 
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5515,RBSTP1557, 1422 Molecular Weight 23052.13 Da.
    Residues 207 Isoelectric Point 5.34
    Sequence aamkvydvtapiyegmpvyknkpekqpkrttitngyvtesridmdvhtgthidaplhmveggatfetip lndlvgpcklfdlthvndritkddiahldiqegdfvlfktknsfedafhfefifvaedaaryladkqir gvgidalgieraqeghpthktlfsagviiieglrlkdvpegryfmvaaplklvgtdaaparvllfdrep
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.21521
    Matthews' coefficent 4.34 Rfactor 0.17559
    Waters 247 Solvent Content 71.45

    Ligand Information
    Ligands SO4 (SULFATE) x 12
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1r61
    1. Mass fractal dimension and the compactness of proteins
    MB Enright, DM Leitner - Physical Review E, 2005 - APS
     
    2. The many faces of radiation-induced changes
    D Borek, SL Ginell, M Cymborowski - Journal of synchrotron , 2006 - scripts.iucr.org
     
    3. Prediction of 3D metal binding sites from translated gene sequences based on remote_homology templates
    R Levy, M Edelman, V Sobolev - Proteins: Structure, Function, , 2009 - Wiley Online Library
     
    4. Proposed arrangement of proteins forming a bacterial type II polyketide synthase
    G Castaldo, J Zucko, S Heidelberger, D Vujaklija - Chemistry & biology, 2008 - Elsevier
     
    5. Crystal structure of yeast YER010Cp, a knotable member of the RraA protein family
    N Leulliot, S Quevillon_Cheruel, M Graille - Protein , 2005 - Wiley Online Library
     
    6. Expression, purification, crystallization and preliminary crystallographic study of a potential metal-dependent hydrolase with cyclase activity from Thermoanaerobacter
    S Liu, G Wu, Q Huang, L Lai, Y Tang - Section F: Structural , 2004 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch