.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r8k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of NAD-dependent dehydrogenase/carboxylase of Salmonella typhimurium. to be published
    Site MCSG
    PDB Id 1r8k Target Id APC22886
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5245,NP_459096, 99287 Molecular Weight 34777.35 Da.
    Residues 329 Isoelectric Point 5.44
    Sequence mssaqrvvitpgepagsgpdlvvqlaqrawpielvvcadgallteraamlglplsllpyspdvpaapqp agtltllpvslrapaisgqltvengpyvvetlaracdgclngefaalitgpvhkgvindagisftghte ffeersqakkvvmmlateelrvalatthlplraiadaitpallheviailhhdlrtkfgiaeprilvcg lnphagegghmgteeidtiipvldelraqgmklngplpadtlfqpkyldnadavlamyhdqglpvlkyq gfgrgvnitlglpfirtsvdhgtalelagrgkadvgsfitalnlaikmivntq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.234
    Matthews' coefficent 2.84 Rfactor 0.208
    Waters 419 Solvent Content 56.70

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals CO (COBALT) x 2;CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 1r8k
    1. Coenzyme biosynthesis: enzyme mechanism, structure and inhibition
    DE Scott, A Ciulli, C Abell - Natural product reports, 2007 - pubs.rsc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch