.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rfz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of hypothetical protein APC35681 from Bacillus stearothermophilus. To be Published
    Site MCSG
    PDB Id 1rfz Target Id APC35681
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5501,RBSTP0885, 1422 Molecular Weight 18555.02 Da.
    Residues 165 Isoelectric Point 4.94
    Sequence msefimnnleqtarrwleergvtvekiaelvyylqskyhpdltmeecienvnrviskrevqnailtgiq ldklaedgrldeplqsiirrdeglygvdeilalsivnvygsigftnygyidkqkpgilqylndkstgkc ntflddivgaiaaaassrlahraanae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.277
    Matthews' coefficent 2.55 Rfactor 0.221
    Waters 117 Solvent Content 51.70

    Ligand Information
    Ligands SO4 (SULFATE) x 7
    Metals

    Jmol

     
    Google Scholar output for 1rfz
    1. Mass fractal dimension and the compactness of proteins
    MB Enright, DM Leitner - Physical Review E, 2005 - APS
     
    2. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    3. Short-Lived _-Helical Intermediates in the Folding of _-Sheet Proteins
    E Chen, ML Everett, ZE Holzknecht, RA Holzknecht - Biochemistry, 2010 - ACS Publications
     
    4. Crystal structure of phosphatidylglycerophosphatase (PGPase), a putative membrane_bound lipid phosphatase, reveals a novel binuclear metal binding site and two
    D Kumaran, JB Bonanno, SK Burley - Proteins: Structure, , 2006 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch