.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rz3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of hypothetical protein RBSTP0775 from Bacillus stearothermophilus. To be Published
    Site MCSG
    PDB Id 1rz3 Target Id APC36099
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5534,RBSTP0775, 1422 Molecular Weight 24219.34 Da.
    Residues 201 Isoelectric Point 5.82
    Sequence melrdridflcktilaiktagrlvlgidglsrsgkttlanqlsqtlreqgisvcvfhmddhiverakry htgneewfeyyylqwdvewlthqlfrqlkashqltlpfydhetdthskrtvylsdsdmimiegvflqrk ewrpffdfvvyldcpreirfarendqvkqniqkfinrywkaedyyleteepikradvvfdmts
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.238
    Matthews' coefficent 2.22 Rfactor 0.203
    Waters 217 Solvent Content 44.64

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 1rz3
    1. Towards the prediction of protein interaction partners using physical docking
    MN Wass, G Fuentes, C Pons, F Pazos - Molecular systems , 2011 - nature.com
     
    2. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    3. Crystal structure and functional analysis identify the P_loop containing protein YFH7 of Saccharomyces cerevisiae as an ATP_dependent kinase
    V Gueguen_Chaignon, V Chaptal - Proteins: Structure, , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch