.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s3j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of YusO protein from Bacillus subtilis, a member of MarR transcriptional regulator family. To be Published
    Site MCSG
    PDB Id 1s3j Target Id APC1698
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4555,O32181, 1423 Molecular Weight 17399.22 Da.
    Residues 155 Isoelectric Point 6.32
    Sequence mksadqlmsdiqlslqalfqkiqpemlesmekqgvtpaqlfvlaslkkhgslkvseiaermevkpsavt lmadrleqknliarthntkdrrvidlsltdegdikfeevlagrkaimarylsflteeemlqaahitakl aqaaetdekqnmkrgng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.273
    Matthews' coefficent 2.19 Rfactor 0.219
    Waters 126 Solvent Content 43.87

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1s3j
    1. Crystal structure of the MarR family regulatory protein, ST1710, from Sulfolobus tokodaii strain 7
    T Kumarevel, T Tanaka, M Nishio, SCB Gopinath - Journal of structural , 2008 - Elsevier
     
    2. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    3. Identification of amino acid residues of Salmonella SlyA that are critical for transcriptional regulation
    N Okada, Y Oi, M Takeda-Shitaka, K Kanou - , 2007 - Soc General Microbiol
     
    4. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    5. The crystal structure of XC1739: A putative multiple antibiotic_resistance repressor (MarR) from Xanthomonas campestris at 1.8 resolution
    KH Chin, ZL Tu, JN Li, CC Chou - PROTEINS: , 2006 - Wiley Online Library
     
    6. Crystallization and preliminary X-ray analysis of AbsC, a novel regulator of antibiotic production in Streptomyces coelicolor
    CEM Stevenson, H Kock, S Mootien - Section F: Structural , 2007 - scripts.iucr.org
     
    7. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    8. PROTEIN THREE-DIMENSIONAL STRUCTURE PROCESSING SYSTEM AND METHOD AND PROGRAM OF PROCESSING PROTEIN THREE-DIMENSIONAL
    H Umeyama, M Shitaka, G Terashi - EP Patent , 2009 - freepatentsonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch