.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s6y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.3A CRYSTAL STRUCTURE OF PHOSPHO-BETA-GLUCOSIDASE, licH Gene Product from BACILLUS STEAROTHERMOPHILUS. To be Published
    Site MCSG
    PDB Id 1s6y Target Id APC36201
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5542,RBSTP2468, 1422 Molecular Weight 49212.36 Da.
    Residues 447 Isoelectric Point 5.77
    Sequence mdkrlkiatigggssytpelveglikryhelpvgelwlvdipegkekleivgalakrmvekagvpieih ltldrrraldgadfvttqfrvgglearakderiplkygvigqetngpgglfkglrtipvildiirdmee lcpdawlinftnpagmvteavlrytkqekvvglcnvpigmrmgvakllgvdadrvhidfaglnhmvfgl hvyldgvevtekvidlvahpdrsgvtmknivdlgwepdflkglkvlpcpyhryyfqtdkmlaeeleaak tkgtraevvqqlekelfelykdpnlaikppqlekrggayysdaacslissiyndkrdiqpvntrnngai asisaesavevncvitkdgpkpiavgdlpvavrglvqqiksfervaaeaavtgdyqtalvamtinplvp sdtiakqildemleahkeylpqffkqakatagn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.31 Rfree 0.25103
    Matthews' coefficent 2.11 Rfactor 0.19403
    Waters 140 Solvent Content 41.66

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1s6y
    1. Breakdown of oligosaccharides by the process of elimination
    VLY Yip, SG Withers - Current opinion in chemical biology, 2006 - Elsevier
     
    2. Family 4 glycoside hydrolases are special: the first _-elimination mechanism amongst glycoside hydrolases
    VLY Yip, SG Withers - Biocatalysis and Biotransformation, 2006 - informahealthcare.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch