.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s7i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.8A crystal structure of a hypothetical protein PA1349 from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 1s7i Target Id APC5031
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4643,NP_250040, 208964 Molecular Weight 12751.96 Da.
    Residues 116 Isoelectric Point 5.34
    Sequence mkylcliyfdeaklaavpaeelaaivdecmtysdqlgkaghyiashalqsvqtattlrhqggrlamtdg pfaetkeqlggfylieardlnqalqiaakippgrlgcvevrpvkewe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.262
    Matthews' coefficent 3.44 Rfactor 0.218
    Waters 57 Solvent Content 63.98

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1s7i
    1. Crystal structure of human antibody 2909 reveals conserved features of quaternary structure-specific antibodies that potently neutralize HIV-1
    A Changela, X Wu, Y Yang, B Zhang, J Zhu - Journal of , 2011 - Am Soc Microbiol
     
    2. Investigating diproline segments in proteins: Occurrences, conformation and classification
    I Saha, N Shamala - Biopolymers, 2012 - Wiley Online Library
     
    3. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    4. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch