.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s9u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 1.38 A crystal structure of DmsD protein from Salmonella typhimurium, a proofreading chaperone on the Tat pathway. Proteins 71 525-533 2008
    Site MCSG
    PDB Id 1s9u Target Id APC23398
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5266,NP_460455, 99287 Molecular Weight 23479.46 Da.
    Residues 204 Isoelectric Point 4.92
    Sequence mttflqrddfavtarvlgalfyyspeshetaplvqallnddwqaqwpldaealapvaamfkthseeslp qawqrlfigpyalpsppwgsvwldresvlfgdstlalrqwmrengiqfemqqnepedhfgsllllaawl aendrhheceqllawhlfpwssrfldvfidhaghpfyqalgqlarltlaqwqaqliipvavkplfr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.38 Rfree 0.18527
    Matthews' coefficent 2.78 Rfactor 0.16133
    Waters 264 Solvent Content 55.74

    Ligand Information
    Ligands SO4 (SULFATE) x 2;PEG (DI(HYDROXYETHYL)ETHER) x 5
    Metals

    Jmol

     
    Google Scholar output for 1s9u
    1. Protein function prediction using local 3D templates
    RA Laskowski, JD Watson, JM Thornton - Journal of Molecular Biology, 2005 - Elsevier
     
    2. Constructing the wonders of the bacterial world: biosynthesis of complex enzymes
    F Sargent - Microbiology, 2007 - Soc General Microbiol
     
    3. An extremely SAD case: structure of a putative redox-enzyme maturation protein from Archaeoglobus fulgidus at 3.4 A resolution
    O Kirillova, M Chruszcz, IA Shumilin - Section D: Biological , 2007 - scripts.iucr.org
     
    4. Physical nature of signal peptide binding to DmsD
    TL Winstone, ML Workentine, KJ Sarfo - Archives of biochemistry , 2006 - Elsevier
     
    5. Identification of Residues in DmsD for Twin-Arginine Leader Peptide Binding, Defined through Random and Bioinformatics-Directed Mutagenesis
    CS Chan, TML Winstone, L Chang, CM Stevens - Biochemistry, 2008 - ACS Publications
     
    6. Fold space unlimited
    MJ Sippl - Current opinion in structural biology, 2009 - Elsevier
     
    7. The 1.38 crystal structure of DmsD protein from Salmonella typhimurium, a proofreading chaperone on the Tat pathway
    Y Qiu, R Zhang, TA Binkowski - Proteins: Structure, , 2008 - Wiley Online Library
     
    8. Structural analysis of a monomeric form of the twin-arginine leader peptide binding chaperone Escherichia coli DmsD
    CM Stevens, TML Winstone, RJ Turner - Journal of molecular , 2009 - Elsevier
     
    9. Comparative protein modeling
    EX Esposito, D Tobi, JD Madura - Reviews in computational , 2006 - Wiley Online Library
     
    10. Structure of the twin-arginine signal-binding protein DmsD from Escherichia coli
    SK Ramasamy, WM Clemons - Acta Crystallographica Section F: , 2009 - scripts.iucr.org
     
    11. Investigating diproline segments in proteins: Occurrences, conformation and classification
    I Saha, N Shamala - Biopolymers, 2012 - Wiley Online Library
     
    12. Structural Analysis of a Monomeric Form of the Twin-Arginine Leader Peptide Binding Chaperone
    E coli DmsD - J. Mol. Biol, 2009 - sfu.ca
     
    13. Comparative Protein Modeling
    JD Maduraz - Reviews in Computational Chemistry, 2006 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch