.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sdi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of Escherichia coli ycfC gene product. To be Published
    Site MCSG
    PDB Id 1sdi Target Id APC70001
    Related PDB Ids 1qz4 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS5575,P25746, 562 Molecular Weight 22946.26 Da.
    Residues 213 Isoelectric Point 9.34
    Sequence maknyyditlalagicqsarlvqqlahqghcdadalhvslnsiidmnpsstlavfggseanlrvgletl lgvlnassrqglnaeltrytlslmvlerklssakgaldtlgnringlqrqlehfdlqsetlmsamaaiy vdvisplgpriqvtgspavlqspqvqakvratllagiraavlwhqvgggrlqlmfsrnrlttqakqila hltpel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.18386
    Matthews' coefficent 2.00 Rfactor 0.15014
    Waters 185 Solvent Content 38.54

    Ligand Information
    Ligands ACY (ACETIC) x 2;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1sdi
    1. HflD, an Escherichia coli protein involved in the _ lysislysogeny switch, impairs transcription activation by _CII
    PK Parua, A Mondal, P Parrack - Archives of biochemistry and biophysics, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1qz4.png
    No description
    30.48 kB22:13, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch